Recombinant Chlamydia muridarum DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Domains

FtsK is a multifunctional protein with distinct domains:

  • N-terminal domain (NTD): Contains four predicted transmembrane helices (34% identity to E. coli FtsK) responsible for septal localization .

  • C-terminal domain (CTD): A conserved ATP-dependent DNA motor (41% identity to E. coli FtsK) with α, β, and γ subdomains. The γ domain recognizes polar sequences (KOPS) to direct DNA translocation toward the chromosomal terminus .

Expression and Purification

ParameterDetails
Expression VectorpBOMB4-Tet or similar
InductionAnhydrotetracycline (aTc)-inducible promoter
Storage BufferTris/PBS with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage

Functional Validation

  • ATPase activity confirmed via enzymatic assays .

  • Localization studies in Chlamydia show dynamic septal and nucleoid-associated foci .

4.1. Divisome Dynamics

  • CRISPRi Knockdown: Transient FtsK suppression blocks divisome assembly and septal PG synthesis in C. trachomatis .

  • Hybrid Divisome: Chlamydia divisomes incorporate elongasome proteins (e.g., MreB, MreC), with FtsK recruiting PBP2/PBP3 transpeptidases .

4.2. DNA Repair and Genome Segregation

  • Radiation Recovery: Deinococcus radiodurans FtsK homolog resolves multipartite genome dimers post-irradiation, highlighting conserved roles in genome maintenance .

Future Directions

  • Real-Time Imaging: Tracking FtsK dynamics during Chlamydia division .

  • Comparative Studies: Exploring FtsK homologs in FtsZ-deficient bacteria (e.g., Planctomyces) .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
As a standard practice, all our proteins are shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
ftsK; TC_0112; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-794
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
ftsK
Target Protein Sequence
MRKERKKASVSLSPQTVFAIKTCIYLALACFSGLSLWSFQHNQPYTQNWIGLLGWSLSSF LLYNFGVAAFLIPLYFGFLSFLNMKKTPAPLAFRKAVAFGTVPVCCAILLSMVSPAQNLP QFLATRVPMVVMDLQPPKAYLGGIPFYLLYDGNSFSLKLLIGAVGTGLIFLAILLCAICY LIPKSFVLKKKALLDALLKFLKNKSYACWSACKKLLKNLVNNKSYCPEPSLRVPAPSSFA KKEVLKLPTPVISLPLENKDLHDGDSSNRTIFLSPPHPAKRTLAPQKKPDLPDLLQKRTS STPIPSSSPSPFIVAGEAPDLPQYHLLSKRNIRRPESLLEELKKKAAILQQTLASFGIDA SIGNICSGPTLAAFEVLPNTGVKVQKIKALENDIALNLQASSIRIIAPIPGKAAVGIEIP NPDPQPVNFRDLLEDYQKGTQRLQVPLLLGKKANGDNFWTDLATMPHLIIAGTTGSGKSV CINTIVMSLIMTSPPTDVKLVIVDPKKVELTGYSQLPHMLTPVITESKEAHSALIWLVRE MELRYEILRFLGLRNIQSFNSRTRNVDIEASYDKEIPEKMPFIVGIIDELSDLLLSSSHD IETPIVRLAQMARAVGIHLILATQRPSRDVITGLIKANFPSRIAFKVANKVNSQIIIDEP GAENLMGNGDMLVVSPGSFAPLRVQGAYICDDDINKVIKDLCSRFPCKYVIPSFDTYDDS SSMDPESLDPLFNQAKTLVLQTGNASTTFLQRKLKIGYARAASIIDQLEEARIVGPSEGA KPRQILVQLSNQED
Uniprot No.

Target Background

Function
Recombinant Chlamydia muridarum DNA translocase FtsK (ftsK) is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in assembling the cell-division machinery, while the C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site. This site is located within the replication terminus region and is essential for activating the Xer recombinase, which in turn enables chromosome unlinking by recombination.
Database Links
Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of chlamydial FtsK compared to other bacterial homologs?

Chlamydial FtsK shares significant homology with FtsK in other bacteria, particularly Escherichia coli. The C-terminus of chlamydial FtsK is 41% identical to the C-terminus of E. coli FtsK, which contains the DNA motor domains responsible for chromosomal segregation. The N-terminus, which is 34% identical to E. coli FtsK, is predicted to encode 4 transmembrane-spanning helices that anchor the protein to the bacterial membrane . Unlike FtsK in most bacteria, chlamydial FtsK does not distribute uniformly at the septum during cell division but rather forms discrete foci at specific locations in the dividing cell .

What is the significance of FtsK in Chlamydia species that lack FtsZ?

FtsK plays a particularly critical role in Chlamydia because, unlike most bacteria, Chlamydia species do not encode FtsZ, which typically serves as the primary scaffold for divisome assembly. In the absence of FtsZ, chlamydial FtsK functions as an essential component for coordinating divisome assembly and cell division through a polarized budding process . This makes FtsK especially significant for understanding the unique cell division mechanisms in this obligate intracellular pathogen.

What experimental evidence supports the role of FtsK in divisome assembly in Chlamydia, and what are the implications for understanding chlamydial cell division?

Experimental evidence for FtsK's role in divisome assembly comes from localization studies and knockdown experiments. When FtsK is knocked down using CRISPRi approaches, divisome assembly is prevented, cell division is inhibited, and septal peptidoglycan synthesis is disrupted . Specifically, transient knockdown of ftsK results in the near-complete disappearance of FtsK foci, and Chlamydia in the inclusion exhibit enlarged aberrant morphology, indicating failed cell division . These findings demonstrate that FtsK is essential for the proper assembly of the divisome complex and subsequent cell division in Chlamydia.

The unique hybrid composition of the chlamydial divisome, containing elements of both the divisome and elongasome from other bacteria, suggests that Chlamydia has evolved an alternative cell division mechanism in the absence of FtsZ. This understanding provides insights into the fundamental adaptations that allow Chlamydia to survive and proliferate as an obligate intracellular pathogen.

How do the recruitment dynamics of divisome proteins in Chlamydia differ from those in FtsZ-containing bacteria, and what does this reveal about chlamydial cell division mechanisms?

In FtsZ-containing bacteria, FtsZ serves as the primary scaffold for divisome assembly, with other proteins recruited in a linear sequential manner. In Chlamydia, the recruitment dynamics are markedly different. Quantitative analysis of the localization profiles of various divisome proteins reveals that FtsK is recruited to nascent divisomes prior to other proteins, including PBP2 and PBP3 transpeptidases, and MreB and MreC .

Specifically, a greater percentage of FtsK is associated with the base of dividing cells compared to other divisome proteins, suggesting its early recruitment to nascent divisome complexes. MreB, which in some bacteria has been suggested to substitute for FtsZ, is actually one of the last proteins recruited to the chlamydial divisome . This indicates that MreB does not function as a scaffold like FtsZ but rather plays a role in the final stages of divisome assembly, specifically in the formation of septal peptidoglycan rings .

What is the relationship between FtsK function and peptidoglycan synthesis in Chlamydia, and how might this inform antimicrobial development strategies?

FtsK plays a critical role in coordinating divisome assembly and peptidoglycan synthesis in Chlamydia. When FtsK is knocked down, not only is divisome assembly prevented, but septal peptidoglycan synthesis is also inhibited . This suggests that FtsK functions as a key regulator that links cell division processes with cell wall synthesis in Chlamydia.

The essential nature of FtsK for chlamydial cell division and its unique functions compared to FtsK in other bacteria make it a potential target for the development of Chlamydia-specific antimicrobials. Compounds that specifically disrupt FtsK function or its interactions with other divisome proteins could inhibit chlamydial replication without affecting beneficial bacteria that rely on FtsZ-dependent division mechanisms.

What are the most effective techniques for visualizing FtsK localization in Chlamydia, and what are their limitations?

Effective visualization of FtsK localization in Chlamydia can be achieved through several complementary approaches:

Limitations include the challenges associated with working with an obligate intracellular pathogen, the small size of chlamydial cells, and the difficulty of assessing cell morphologies in densely packed inclusions in infected cells. To overcome these challenges, researchers have developed approaches to analyze isolated Chlamydia derived from lysates of infected cells at specific time points post-infection .

What genetic manipulation strategies are most effective for studying FtsK function in Chlamydia, considering its essential role in cell division?

Several genetic manipulation strategies have proven effective for studying FtsK function in Chlamydia:

  • CRISPRi knockdown approach: CRISPR interference using catalytically dead Cas12 (dCas12) can be employed to transiently downregulate ftsK expression. This approach involves transforming Chlamydia with plasmids encoding dCas12 and a guide RNA targeting ftsK under an anhydrotetracycline (aTc)-inducible promoter . The effectiveness of knockdown can be verified by RT-qPCR to measure reduction in ftsK transcript levels .

  • Inducible expression of tagged proteins: Transformation with plasmids encoding FtsK fused to fluorescent proteins (e.g., mCherry) under an inducible promoter allows for controlled expression and localization studies. This approach can be used to examine the effects of overexpression or to study protein-protein interactions .

  • Fluorescent D-amino acid (FDAA) labeling: To study the relationship between FtsK and peptidoglycan synthesis, FDAA labeling can be employed to visualize sites of active peptidoglycan synthesis in relation to FtsK localization .

Given the essential nature of FtsK, complete knockouts are likely lethal, which limits certain genetic approaches. Inducible or titratable systems that allow for partial or temporary loss of function are therefore particularly valuable for studying essential proteins like FtsK in Chlamydia.

How can researchers effectively analyze the temporal dynamics of FtsK recruitment during chlamydial cell division?

To analyze the temporal dynamics of FtsK recruitment during chlamydial cell division, researchers can employ the following approaches:

  • Time-course studies with synchronized infections: By synchronizing Chlamydia infections and analyzing FtsK localization at various time points throughout the developmental cycle, researchers can track the temporal progression of FtsK recruitment to division sites.

  • Dual-labeling with markers of cell division stages: Co-labeling FtsK with markers that indicate specific stages of cell division, such as membrane dyes or other divisome proteins with known recruitment timing, can help establish the temporal sequence of events.

  • Quantitative analysis of localization patterns: By categorizing cells based on their division stage (e.g., non-dividing, early division with visible septum, late division) and quantifying the percentage of cells with specific FtsK localization patterns at each stage, researchers can infer the temporal dynamics of FtsK recruitment .

  • Live-cell imaging: Although technically challenging with Chlamydia, advances in microscopy and genetic tools may enable real-time visualization of FtsK dynamics during cell division in living infected cells.

  • Correlative light and electron microscopy: This approach can provide high-resolution structural information about the precise localization of FtsK in relation to cellular ultrastructure at different stages of division.

What are the key protein-protein interactions of FtsK in the chlamydial divisome complex, and how can they be characterized?

Future research should focus on identifying and characterizing the key protein-protein interactions of FtsK in the chlamydial divisome complex. Potential approaches include:

  • Proximity-dependent biotin labeling: Techniques such as BioID or APEX can be used to identify proteins in close proximity to FtsK during cell division.

  • Co-immunoprecipitation followed by mass spectrometry: This approach can help identify proteins that physically interact with FtsK in Chlamydia.

  • Bacterial two-hybrid assays: Modified for use with chlamydial proteins, these assays can test specific protein-protein interactions in a heterologous system.

  • FRET (Förster Resonance Energy Transfer): This technique can detect direct interactions between FtsK and other divisome proteins when fused to appropriate fluorophores.

  • Structural studies: Crystallography or cryo-EM of FtsK alone or in complex with interaction partners can provide detailed information about binding interfaces and mechanism of action.

Understanding these interactions will provide insights into how FtsK coordinates divisome assembly in the absence of FtsZ and may reveal potential targets for therapeutic intervention.

How does the DNA translocase activity of FtsK contribute to chromosome segregation in Chlamydia, and how is this coordinated with cell division?

The DNA translocase activity of FtsK is known to play a crucial role in chromosome segregation in other bacteria, particularly in resolving chromosome dimers and ensuring complete chromosome separation before cell division . Future research should investigate how this activity functions in Chlamydia:

  • Identification of chlamydial KOPS (FtsK Orienting Polar Sequences): Determining whether Chlamydia possesses KOPS sequences that guide FtsK directionality during DNA translocation.

  • Characterization of XerCD-dif system: Investigating whether Chlamydia uses a XerCD-dif recombination system for chromosome dimer resolution, as in other bacteria, and how FtsK interacts with this system.

  • Domain-specific mutations: Creating mutations in the DNA motor domains of FtsK to separate its structural role in divisome assembly from its function in DNA translocation.

  • Chromosome conformation capture techniques: These could reveal how FtsK-mediated DNA translocation affects the three-dimensional organization of the chlamydial chromosome during cell division.

Understanding the dual roles of FtsK in coordinating chromosome segregation and cell division will provide a more complete picture of chlamydial cell cycle regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.