Recombinant Chlamydia muridarum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Biological Role of YidC in Chlamydia muridarum

YidC facilitates the co-translational insertion of membrane proteins into the bacterial inner membrane, a process critical for maintaining membrane integrity and virulence . In C. muridarum, YidC (TC0668) localizes exclusively within chlamydial inclusions and peaks in expression during the replicative phase (16 hours post-infection) . Its disruption reduces urogenital pathogenicity by modulating cytokine secretion (e.g., downregulating IL-6 and upregulating MCP-1) .

Key Functional Insights:

  • Localization: Confined to chlamydial inclusions, as shown by immuno-electron microscopy .

  • Expression Dynamics:

    Time Post-InfectionTranscript Level (Relative to pgp8)Protein Abundance
    4 hLowDetectable
    16 hPeakMaximum
    24 hStableDeclining

Mechanistic Insights from Homologous Systems

Studies on E. coli YidC reveal conserved mechanisms:

  • Substrate Interaction: YidC’s transmembrane helices (TM3, TM5) directly contact nascent membrane proteins .

  • Membrane Thinning: Induces bilayer thinning by 7–10 Å at insertion sites, reducing hydrophobic mismatch .

  • Sec-Independent Insertion: Demonstrated for single-spanning proteins like Pf3 coat, which integrate into proteoliposomes containing purified YidC .

Critical Residues for Activity :

  • T362 (TM2) and Y517 (TM6): Essential for YidC function; alanine substitutions abolish activity.

  • Hydrophilic cytoplasmic regions: Mediate initial substrate recognition.

Impact on C. muridarum Pathogenicity

Disruption of tc0668 via mutagenesis significantly attenuates infection:

  • Cytokine Modulation: Infection with tc0668 mutants reduces pro-inflammatory cytokines (e.g., IL-1α, IL-12) by >50% while increasing anti-inflammatory signals (e.g., IL-10) .

  • Developmental Defects: Impaired re-differentiation of reticulate bodies (RBs) into elementary bodies (EBs), critical for infectivity .

Implications for Vaccine Development

While YidC itself is not a direct vaccine candidate, its regulatory role in membrane protein biogenesis highlights its indirect importance. For example:

  • MOMP-Based Vaccines: Co-expression with Bam complex improves outer membrane localization of MOMP in E. coli, a strategy adaptable for chlamydial antigen production .

  • Adjuvant Targeting: YidC-dependent cytokines (e.g., MCP-1) could be modulated to enhance vaccine efficacy .

Unresolved Questions and Future Directions

  • Structural Resolution: Cryo-EM studies of C. muridarum YidC-ribosome complexes are needed to clarify insertion mechanisms.

  • Substrate Specificity: Identification of YidC-dependent membrane proteins in Chlamydia remains incomplete.

  • Therapeutic Targeting: Small-molecule inhibitors of YidC could disrupt chlamydial development without harming host cells.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
yidC; TC_0522; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-787
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
yidC
Target Protein Sequence
CQIFFGYQDLKSCQDLAEKQRAISEQILASTEQLSVVPWTASAEESESVNQYAVRLGNRL LVLTKGGAHSEVHSKGTSWKLIDQTSTFGGILVSLYGEDGQEVLSKGGSVYLPNQQDALP VLVAEFRRNQEPLVFFGEYKNGKLSNKAGTIYGTSLVFLNTGNEFVPLGIYNSKEECVES LDLPMARAVVFADKENLTTSGSYYMLANEYMQVIVSQESGAIEGINLPFASDREGNKSIV NEIGFDRELAAGSPSEASFPGVQAIDSQRQNVSSVVGGYYPLLRRGTLSDTRKMVSPQYQ ALNIVSGRELSSPVATGFRVVSFDNKTLVLESGDGGIRKTYTLGEQPYAFDLEIQTTRGQ EDLWITSGVPEVEIMSNAFVPAVKYHAVKKNKSDLINVKLPKAKDSLLVRNDASPQWILN SNGYFGVILTPKTPLPTGYASSFIPGNAVPTRLTQLSPKDQAYPASKYPGYTAMLPLPKE AGRYQFMVYAGPLSEPTLKALDRAHTNHKGESPEYVDAIAFRGFFSFITEPFAALLFIIM KFFQFLTGSWGISIILLTIVLKLVLYPLNAWSIRSMRRMQKLSPYIQDIQQKYKREPKRA QMEIMALYKVNKVNPITGCLPLIIQIPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDV LFSWETPIWFIGKEFHLLPILLGIVMFAQQKISAIKRSGPVSDQQRQQEAMGTMMALLFT FMFYNFPSGLNIYWLSSMLLGVIQQWATNKILDEKHLQHEVIVNKKR
Uniprot No.

Target Background

Function
YidC is a membrane protein insertase essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a crucial role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in bacterial membrane protein biology?

YidC is a universally conserved membrane protein that mediates the integration of membrane proteins into the cytoplasmic membrane of bacteria. It functions as a membrane protein insertase, operating either independently or in concert with the SecY complex during co-translational membrane protein insertion . The protein plays a critical role in maintaining proper membrane composition by facilitating the correct folding and insertion of newly synthesized membrane proteins as they emerge from the ribosome .

In bacterial systems such as E. coli, YidC has been structurally characterized with five conserved transmembrane domains and a distinctive helical hairpin between transmembrane segments 2 and 3 that extends to the cytoplasmic membrane surface . This structural arrangement creates a specific interface between the protein and membrane lipids that serves as the insertion site for nascent membrane proteins .

How does YidC interact with ribosomes during protein translation?

YidC interacts with ribosomes at the ribosomal tunnel exit during co-translational membrane protein insertion. According to structural studies using cryo-electron microscopy, a single copy of YidC docks at the ribosomal exit tunnel where the nascent polypeptide chain emerges . This strategic positioning allows YidC to receive the emerging membrane protein directly from the ribosome and guide its insertion into the membrane bilayer .

The interaction involves specific amino acid residues in YidC that bind to the ribosome, creating a protected environment for the nascent chain to move from the aqueous environment of the ribosome interior to the hydrophobic membrane environment . This alignment between the ribosomal exit tunnel and the YidC insertion site is crucial for efficient and accurate membrane protein biogenesis.

What experimental approaches are used to study C. muridarum pathogenesis?

Research on C. muridarum pathogenesis employs several key experimental approaches:

  • Mouse infection models: C. muridarum is frequently used to establish murine models of female upper genital tract infection, serving as a model for human C. trachomatis infections . These models allow assessment of bacterial burden through inclusion-forming unit (IFU) quantification and evaluation of pathological damage .

  • Proteomics analysis: Techniques such as isobaric tags for relative and absolute quantitation (iTRAQ) enable comprehensive screening of differentially expressed proteins during infection . This approach has been used to identify proteins involved in inflammatory responses, fibrosis, metabolic processes, and complement coagulation cascades during C. muridarum infection .

  • Genetic manipulation: Creation of mutant strains through targeted gene modification, such as the TC0668 mutant strain, allows investigation of specific virulence factors . Comparison between wild-type and mutant strains provides insights into the roles of individual proteins in pathogenesis .

  • Immunological assays: Assessment of T-cell responses, cytokine production (particularly IFN-γ and IL-2), and characterization of CD4+ memory and effector T-cells helps elucidate protective immune mechanisms against C. muridarum infections .

What structural and functional insights have been gained about membrane insertases through computational modeling?

Advanced computational approaches have significantly enhanced our understanding of membrane insertases like YidC:

Evolutionary co-variation analysis has emerged as a powerful tool for predicting contacts between pairs of residues, enabling the construction of structural models even in the absence of crystal structures . For YidC, this approach has revealed specific helix-helix interactions that define the protein's structure. The analysis identified seven helix-helix contacts with probabilities above 57%, while all other possible contacts scored below 15%, demonstrating the specificity of the method .

Computational models have revealed that YidC forms a pentagonal arrangement of transmembrane helices when viewed from the cytoplasm, in the order 4-5-3-2-6 (clockwise) . This arrangement creates a specific protein-lipid interface that serves as the insertion site for membrane proteins .

Molecular dynamics (MD) simulations have provided insights into the stability and biochemical properties of YidC in the bacterial membrane environment . These simulations have shown that the five transmembrane helices form a rigid protein core, while polar loop regions interact with the membrane surface . The stability of YidC is maintained through hydrophobic residues on the exterior of the transmembrane bundle that interact with apolar lipid tails, while the core is stabilized by both short and long-range interactions between the five helices .

How do specific mutations in virulence factors affect C. muridarum pathogenicity?

Mutations in specific virulence factors can dramatically alter C. muridarum pathogenicity, as demonstrated by studies on TC0668:

The TC0668 G216* mutation, which changes the glycine (GGA) codon at position 216 to a stop codon (TGA), results in significantly attenuated virulence compared to wild-type strains . This mutation leads to reduced pathological damage in the upper genital tract of mice, indicating TC0668's role as a chromosomal virulence protein important for pathogenesis .

Proteomics analysis comparing wild-type and mutant TC0668 strains revealed 550 differentially expressed proteins at 18 hours post-infection, with 222 up-regulated and 328 down-regulated proteins in the mutant strain-infected cells . These differences highlight the extensive impact of a single virulence factor on host cell responses.

The TC0668 mutation affects key signaling pathways including PI3K/Akt and NF-κB pathways . Cells infected with wild-type TC0668 showed significantly higher levels of PI3K and phosphorylated Akt (p-Akt) compared to mutant-infected cells, while p53 levels were significantly lower in wild-type-infected cells . These molecular differences likely contribute to the reduced ability of the mutant strain to induce hydrosalpinx and cause pathological damage.

What methodologies are most effective for analyzing protein-protein interactions in membrane-associated bacterial virulence factors?

Several complementary methodologies have proven effective for analyzing protein-protein interactions involving membrane-associated bacterial virulence factors:

Quantitative proteomics using iTRAQ: This high-throughput technique offers high sensitivity for investigating complex biological functions and pathogenesis mechanisms . In studies of C. muridarum TC0668, iTRAQ allowed identification of hundreds of differentially expressed proteins between wild-type and mutant strains, providing comprehensive insights into affected cellular pathways .

Validation through qRT-PCR: Following proteomics analysis, quantitative real-time PCR provides validation of differential protein expression at the transcriptional level . This two-tiered approach strengthens the reliability of findings by confirming changes through independent methodologies.

Western blotting and immunofluorescence detection: These techniques allow direct visualization and quantification of proteins involved in key signaling pathways, such as PI3K/Akt and NF-κB pathways in the case of TC0668 studies .

Protein-protein interaction network analysis: This computational approach integrates differentially expressed proteins into interaction networks, revealing functional relationships between proteins involved in processes such as inflammation and fibrosis . This systems-level analysis helps identify key nodes and pathways in the pathogenesis process.

How do immune responses differ between primary infection and re-challenge with C. muridarum?

Immune responses to C. muridarum infection demonstrate important differences between primary infection and re-challenge scenarios:

During primary infection, subcutaneous (SC) immunization with extended-releasing PLGA 85:15 encapsulated recombinant MOMP (rMOMP) nanovaccine provides better protection than intranasal (IN) immunization, as evidenced by lower inclusion-forming units (IFU) . This protection is associated with Th1 immune effectors, particularly IFN-γ and IL-2 production, along with CD4+ memory and effector T-cells .

Upon re-challenge, both SC- and IN-immunized mice show enhanced protection compared to PBS controls, indicating the development of robust adaptive immunity . This enhanced protection results from a combination of vaccine-induced immunity and infection-induced immunity-boosting effects from the first challenge .

Interestingly, even PBS control mice show earlier reduction in bacterial burden (by day 12) after re-challenge compared to primary infection, suggesting that the first challenge stimulates infection-induced immunity that partially protects against subsequent exposure .

The protective immunity against re-challenge involves CD4+ T-cell-driven immune responses with pronounced IFN-γ production, which aligns with findings from studies of C. trachomatis-infected women showing that Chlamydia-specific CD4+ derived IFN-γ responses protect against re-infection .

What protein purification strategies are most effective for recombinant membrane proteins from C. muridarum?

Effective purification of recombinant membrane proteins from C. muridarum requires specialized approaches to address their hydrophobic nature and complex folding requirements:

  • Expression system selection: E. coli expression systems can be used for producing recombinant C. muridarum membrane proteins, but careful optimization of expression conditions is essential to prevent protein aggregation and maintain native-like folding.

  • Solubilization strategies: Detergent-based solubilization is critical for extracting membrane proteins from lipid bilayers. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often provide a good balance between efficient extraction and maintaining protein structure.

  • Affinity chromatography: Addition of affinity tags (His-tag, GST, etc.) facilitates selective purification using immobilized metal affinity chromatography (IMAC) or glutathione affinity chromatography. For YidC specifically, C-terminal tagging is generally preferred to avoid interference with membrane insertion.

  • Size exclusion chromatography: This technique provides further purification and allows assessment of protein homogeneity and oligomeric state. For YidC, careful monitoring of elution profiles can distinguish between monomeric and potentially oligomeric forms.

  • Quality control: Circular dichroism spectroscopy can verify proper folding of purified membrane proteins, while functional assays specific to the protein's activity should be employed to confirm biological activity.

What are the challenges and solutions in structural studies of YidC from pathogenic bacteria?

Structural studies of YidC from pathogenic bacteria present several challenges with corresponding methodological solutions:

Challenges:

  • Membrane proteins like YidC are difficult to crystallize due to their hydrophobic nature and conformational flexibility

  • Maintaining the native structure outside the membrane environment

  • Low expression yields compared to soluble proteins

  • Potential toxicity when overexpressed in heterologous hosts

Solutions:

  • Evolutionary co-variation analysis: This computational approach has proven valuable for predicting contacts between pairs of residues and building structural models . For YidC, this method successfully identified specific helix-helix interactions that defined the protein's structure .

  • Cryo-electron microscopy: This technique allows visualization of YidC in complex with ribosomes and nascent chains, providing insights into functional states . Recent advances in cryo-EM have improved resolution, enabling visualization of side-chain interactions.

  • Molecular dynamics simulations: MD simulations provide insights into the stability and dynamics of YidC in membrane environments . These simulations have helped validate structural models by assessing their stability and identifying key stabilizing interactions .

  • Lipid nanodiscs: Reconstituting YidC into lipid nanodiscs provides a more native-like membrane environment compared to detergent micelles, potentially preserving functionally relevant conformations.

How can PLGA-based nanoparticle systems be optimized for delivery of recombinant C. muridarum membrane proteins?

PLGA (poly(lactic-co-glycolic acid)) nanoparticle systems can be optimized for delivery of recombinant C. muridarum membrane proteins through several approaches:

Polymer composition optimization: The ratio of lactic acid to glycolic acid in PLGA affects degradation rate and release kinetics. Extended-releasing PLGA 85:15 has shown effectiveness for encapsulating recombinant MOMP from C. muridarum, conferring protective immunity against genital challenge in mice . This specific composition provides sustained antigen release, enhancing immune responses.

Encapsulation methods: Various techniques including double emulsion solvent evaporation, nanoprecipitation, or spray drying can be employed, with selection based on the specific membrane protein characteristics. For hydrophobic membrane proteins, single emulsion or nanoprecipitation may be preferable.

Surface modification: PLGA nanoparticles can be surface-modified with targeting moieties to enhance delivery to specific cell types. For mucosal immunity against C. muridarum, modifications that target antigen-presenting cells in mucosal tissues may improve vaccine efficacy.

Adjuvant co-delivery: Co-encapsulation of immune stimulants with the recombinant membrane protein can enhance immunogenicity. Studies with PLGA-encapsulated rMOMP have demonstrated enhanced production of protective chlamydial-specific Th1 cytokines (IFN-γ and IL-2) and CD4+ memory and effector T-cells .

Administration route optimization: Different routes of administration affect immune response characteristics. Subcutaneous immunization with PLGA-rMOMP has been shown to afford better protection after the first C. muridarum challenge compared to intranasal immunization, as evidenced by lower inclusion-forming units (IFU) .

How do signaling pathways affected by C. muridarum virulence factors contribute to pathogenesis?

C. muridarum virulence factors significantly impact host cell signaling pathways, contributing to pathogenesis through multiple mechanisms:

The PI3K/Akt signaling pathway is differentially activated during infection with wild-type versus mutant C. muridarum strains . Cells infected with C. muridarum TC0668 wild-type strains display significantly higher levels of PI3K compared to TC0668 mutant-infected cells at multiple time points post-infection . Similarly, the relative expression level of phosphorylated Akt (p-Akt/Akt) is significantly higher in wild-type-infected cells . This increased PI3K/Akt activation may contribute to altered cellular survival and inflammatory responses.

The NF-κB signaling pathway, critical for inflammatory responses, is also differentially activated between wild-type and mutant TC0668 strains . This pathway regulates the expression of numerous genes involved in inflammation and immune responses, suggesting that modulation of NF-κB signaling by C. muridarum virulence factors directly influences the inflammatory damage characteristic of chlamydial infections.

The p53 tumor suppressor pathway is downregulated by wild-type TC0668, as evidenced by significantly lower p53 levels in wild-type-infected cells compared to mutant-infected cells . Since p53 is typically downregulated by activation of the PI3K/Akt pathway, this observation correlates with the enhanced PI3K/Akt signaling observed in wild-type infections .

Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analyses of differentially expressed proteins between wild-type and mutant infections reveal impacts on inflammatory responses, fibrosis, metabolic processes, and complement coagulation cascades . This multi-pathway disruption likely contributes to the complex pathology observed during C. muridarum infection.

What role might YidC play in the assembly of virulence-associated membrane protein complexes in C. muridarum?

As a membrane protein insertase, YidC likely plays a crucial role in the assembly of virulence-associated membrane protein complexes in C. muridarum:

YidC mediates the integration of membrane proteins either independently or in concert with the SecY complex . This function is essential for the proper assembly of membrane-embedded virulence factors that C. muridarum requires for host cell invasion, immune evasion, and pathogenesis.

The structural model of YidC reveals a specific site for membrane protein insertion at the YidC protein-lipid interface . This site likely facilitates the insertion of various virulence factors into the bacterial membrane, ensuring their proper folding and orientation for functional activity.

YidC interacts with ribosomes at the ribosomal tunnel exit during co-translational membrane protein insertion . This interaction allows nascent virulence factors to be directly guided from the ribosome into the membrane, minimizing misfolding and aggregation that could compromise pathogen fitness.

The helical hairpin between transmembrane segments 2 and 3 of YidC extends to the cytoplasmic membrane surface , potentially providing a platform for interactions with cytoplasmic chaperones or assembly factors that might be required for the maturation of complex virulence-associated membrane protein structures.

While direct evidence from C. muridarum is limited, insights from YidC function in other bacteria suggest it would be essential for the biogenesis of membrane proteins involved in host-pathogen interactions, including adhesins, invasins, and components of secretion systems.

How do immune responses to recombinant C. muridarum membrane proteins compare between different vaccination strategies?

Comparison of immune responses between different vaccination strategies using recombinant C. muridarum membrane proteins reveals important differences in protective efficacy:

Route of administration effects: Subcutaneous (SC) immunization with PLGA-encapsulated recombinant MOMP (rMOMP) provides better protection against primary C. muridarum challenge compared to intranasal (IN) immunization . This is evidenced by lower inclusion-forming units (IFU) in all SC-immunized mice, contrasting with higher and more variable IFU counts in the IN-immunized group .

Primary vs. secondary response differences: During re-challenge experiments, both SC- and IN-immunized mice demonstrate enhanced protection compared to controls, suggesting that both vaccination routes can establish memory responses . This enhanced protection during re-challenge appears to result from a combination of vaccine-induced immunity and infection-induced immunity-boosting effects from the first challenge .

T-cell response characteristics: Both vaccination routes generate protective chlamydial-specific Th1 cytokines (IFN-γ and IL-2) and CD4+ memory and effector T-cells, which are crucial for clearing C. muridarum vaginal infections . These T-cell responses correlate with IFN-γ-mediated Chlamydia killing through T-cell activation .

Translational relevance: The protective mechanisms observed in mouse models align with studies in C. trachomatis-infected women, which show that Chlamydia-specific CD4+ derived IFN-γ responses protect against re-infection . This correlation between mouse and human studies strengthens the translational potential of these vaccination approaches.

What are the key differences in structural and functional properties between YidC from C. muridarum and other bacterial species?

While the search results don't provide specific structural information about C. muridarum YidC, we can infer likely differences based on general principles of YidC conservation and variation across bacterial species:

Conserved core structure: The membrane-integrated core of YidC typically forms a helical bundle arranged like the vertices of a pentagon, in the order 4-5-3-2-6 (clockwise) when viewed from the cytoplasm . This pentagonal arrangement of five transmembrane domains is likely conserved in C. muridarum YidC, as it represents the functional core of the protein.

Helical paddle domain: A distinctive feature of E. coli YidC is the helical hairpin (termed the "helical paddle domain" or HPD) between transmembrane segments 2 and 3 that extends to the cytoplasmic membrane surface . The base of this domain is structurally constrained by contacts with TM3, while its tip is more mobile and appears to interact with lipid headgroups . Variation in this domain between species may influence substrate specificity.

Species-specific adaptations: Different bacterial species often show adaptations in their YidC proteins that reflect their ecological niches and membrane compositions. For C. muridarum, as an obligate intracellular pathogen, its YidC may have evolved specific features to handle membrane proteins required for host cell invasion and intracellular survival.

Interaction with accessory factors: YidC proteins from different species vary in their interactions with accessory factors. As an obligate intracellular pathogen with a reduced genome, C. muridarum may have evolved a streamlined insertion machinery with potentially fewer interacting partners compared to free-living bacteria.

Substrate specificity: The substrate range of YidC varies between bacterial species. C. muridarum YidC is likely specialized for the insertion of membrane proteins involved in its unique pathogenic lifestyle, potentially including proteins involved in avoiding host immune detection or facilitating intracellular replication.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.