Recombinant Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA)

What is the structural composition of recombinant C. muridarum cdsA protein?

Recombinant Full Length Chlamydia muridarum Phosphatidate cytidylyltransferase (cdsA) is a 305 amino acid protein (Q9PJU1). The protein sequence includes: "MFDSDKNSILQSDFCQRLVVHSLLLVFLVILLCTSLYPSSAFIVGLLSSTCAAIGTYEMS SMVRMKFPFSFTRYSSIGSAIFVALTCLTARCKMLLPEHVDLIPWFFLFFWTVHLVFKSR HYKLGPIGSTGLALFCMLYVSVPIRLFL", though this represents only a portion of the full sequence. For research applications, the protein is typically expressed with an N-terminal His-tag to facilitate purification .

What expression systems are most effective for recombinant C. muridarum cdsA production?

E. coli expression systems have proven successful for the production of recombinant C. muridarum cdsA protein as evidenced by commercial availability of the His-tagged protein expressed in E. coli . When designing expression protocols, researchers should consider that membrane-associated proteins like cdsA may require optimization of induction temperature, IPTG concentration, and expression duration to balance protein yield with proper folding. Comparing codon-optimized constructs with native sequences may further improve expression efficiency.

How does temperature affect the stability of recombinant cdsA during experimental procedures?

As a membrane-associated protein, cdsA requires careful handling to maintain stability. While specific stability data for C. muridarum cdsA is limited, researchers should implement a temperature-controlled workflow based on related bacterial membrane proteins. Store lyophilized protein at -20°C and reconstituted protein at 4°C for short-term use or aliquoted at -80°C for long-term storage to preserve enzymatic activity. Avoid repeated freeze-thaw cycles, which can significantly impact protein functionality.

What purification strategies yield highest purity and activity for recombinant cdsA?

For optimal purification of His-tagged recombinant cdsA, implement a multi-stage protocol:

• Initial capture using Ni-NTA affinity chromatography with gradual imidazole elution (20-250mM)

• Size exclusion chromatography to remove aggregates and improve homogeneity

• Optional ion exchange chromatography for removal of E. coli contaminants

Include 0.05-0.1% mild detergent (such as DDM or CHAPS) in all buffers to maintain solubility of this membrane-associated protein. Verify purity using SDS-PAGE and Western blotting with anti-His antibodies, and confirm activity using phosphatidate cytidylyltransferase assays measuring CTP to CDP-DAG conversion.

How can researchers validate the enzymatic activity of purified recombinant cdsA?

Validate enzymatic activity through a radiometric assay measuring the conversion of [14C]phosphatidic acid and CTP to [14C]CDP-diacylglycerol. Alternatively, employ a coupled enzyme assay where pyrophosphate released during the reaction is quantified. Enzymatic parameters should be determined under various conditions (pH 6.5-8.0, Mg2+ concentrations 5-20mM) to establish optimal reaction conditions. Include appropriate controls such as heat-inactivated enzyme and reactions without CTP substrate.

How does cdsA contribute to C. muridarum membrane formation and bacterial viability?

As a phosphatidate cytidylyltransferase, cdsA catalyzes a critical step in phospholipid biosynthesis, converting phosphatidic acid to CDP-diacylglycerol. This intermediate serves as a precursor for phosphatidylinositol, phosphatidylglycerol, and cardiolipin synthesis. In Chlamydia, which undergoes distinct developmental stages (elementary and reticulate bodies), membrane composition is crucial for survival and host cell interaction. Research suggests that phospholipid biosynthesis enzymes like cdsA are essential for maintaining membrane integrity during the transition between these developmental forms.

What role might cdsA play in genetic manipulation studies of C. muridarum?

While not directly addressed in the provided literature for cdsA specifically, genetic transformation technology has been developed for Chlamydia using endogenous plasmids. The studies on plasmid tropism between C. trachomatis and C. muridarum indicate species-specific barriers at the level of plasmid replication or maintenance rather than transformation . Researchers investigating genetic manipulation of C. muridarum should consider these species-specific factors when designing cdsA expression or knockout studies.

Could cdsA serve as a potential antigen for vaccine development against C. muridarum?

While the provided research does not specifically address cdsA as a vaccine candidate, studies on C. muridarum proteins as vaccine targets provide a methodological framework. Research has shown that multisubunit vaccines containing polymorphic membrane proteins (Pmps) conferred significant protection against C. muridarum genital tract infection . To evaluate cdsA as a potential vaccine antigen, researchers should:

• Assess MHC class II binding of cdsA-derived peptides

• Evaluate CD4+ T cell responses to cdsA epitopes

• Test recombinant cdsA in murine genital tract infection models

• Measure accelerated clearance as an indicator of protection

How might cdsA interact with the host immune system during C. muridarum infection?

Based on studies of other C. muridarum proteins, researchers investigating cdsA's interaction with host immunity should consider both innate and adaptive immune responses. C. muridarum-specific CD4 T-cell clones can recognize infected upper reproductive tract epithelial cells as early as 12 hours post-infection . The timing and degree of T-cell activation depend on the interferon milieu, with IFN-β and IFN-γ having different effects on T-cell activation . To investigate whether cdsA-specific T cells contribute to immunity:

• Generate cdsA-specific CD4 T-cell clones

• Test recognition of infected epithelial cells

• Assess MHC-II restriction using blocking antibodies

• Evaluate the effects of different cytokine environments on T-cell activation

What methodological approaches can assess the impact of cdsA inhibition on C. muridarum replication?

To evaluate cdsA as a potential therapeutic target, researchers should implement a multi-faceted approach:

• Design small molecule inhibitors targeting the active site based on structural predictions

• Develop conditional knockdown systems to regulate cdsA expression

• Assess growth kinetics and inclusion morphology following inhibition

• Measure phospholipid composition changes using mass spectrometry

• Evaluate effects on elementary body formation and infectivity

Combine these approaches with in vitro infection models using epithelial cell lines that support C. muridarum replication.

What are the common challenges in working with recombinant membrane proteins like cdsA?

Membrane proteins present several challenges in recombinant expression and handling:

• Low expression levels and inclusion body formation

• Protein misfolding and aggregation

• Loss of activity during purification

• Limited stability in solution

To address these challenges, researchers should optimize expression conditions (temperature, induction time, host strain), incorporate solubilizing agents (detergents, lipids), and carefully control buffer composition throughout purification and storage.

How can researchers overcome solubility issues with recombinant cdsA?

To improve solubility of recombinant cdsA:

• Express as a fusion protein with solubility-enhancing tags (MBP, SUMO, thioredoxin)

• Test various detergents (DDM, LDAO, CHAPS) at concentrations above their critical micelle concentration

• Include glycerol (5-10%) in all buffers to stabilize the protein

• Optimize salt concentration (typically 150-300mM NaCl) to reduce aggregation

• Consider nanodiscs or liposome reconstitution for functional studies

Each optimization step should be validated by measuring protein activity to ensure that improved solubility doesn't come at the cost of functional integrity.