Recombinant Chlamydia muridarum Probable metal transport system membrane protein TC_0698 (TC_0698)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TC_0698; Probable metal transport system membrane protein TC_0698
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
TC_0698
Target Protein Sequence
MLMISILYSLFPPLLFPSLLAAFGASIAGGIVGSYIVVKRIVSISGSIAHSILGGVGIAL WLQYQFDLPISPLHGAIASAIFVAICIGNVHLKYHEREDSIISMIWSIGMAVGMLCISKL PSFNSDLADFLFGNILWVTSRDLYFLGILDLLIVATVSICHTRFLALCFDEKYMALNRYS IKAWYFLLLILTAITTVVLMYVMGVILMLSMLVLPVSIACRFSYKMSSIIFTASILNICC SFLGIILAYILDLPVGPIIAILMGIAYSLSLLLKRSCNTSTPSPVSPESKINS
Uniprot No.

Target Background

Function
This protein is part of an ATP-driven transport system (TC_0696/TC_0697/TC_0698) responsible for the transport of a specific metal.
Database Links
Protein Families
ABC-3 integral membrane protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is TC_0698 and what is its basic structural composition?

TC_0698 is a probable metal transport system membrane protein found in Chlamydia muridarum. It consists of 293 amino acids and functions as a membrane-associated protein likely involved in metal ion transport mechanisms. The protein is available as a recombinant full-length protein with an N-terminal His-tag when expressed in E. coli systems . The complete amino acid sequence is:

MLMISILYSLFPPLLFPSLLAAFGASIAGGIVGSYIVVKRIVSISGSIAHSILGGVGIALWLQYQFDLPISPLHGAIASAIFVAICIGNVHLKYHEREDSIISMIWSIGMAVGMLCISKLPSFNSDLADFLFGNILWVTSRDLYFLGILDLLIVATVSICHTRFLALCFDEKYMALNRYSIKAWYFLLLILTAITTVVLMYVMGVILMLSMLVLPVSIACRFSYKMSSIIFTASILNICCSFLGIILAYILDLPVGPIIAILMGIAYSLSLLLKRSCNTSTPSPVSPESKINS

Analysis of this sequence suggests a structure typical of transmembrane proteins involved in metal transport, with multiple membrane-spanning domains that create channels or pores for the selective passage of metal ions across cellular membranes.

How does TC_0698 relate to other known metal transport proteins?

TC_0698 shares functional similarity with other metal transport proteins like divalent metal transporters (DMTs) found across different species. While structurally distinct from the DMT1 proteins found in Plasmodium falciparum and mammalian systems, TC_0698 likely employs similar mechanisms for metal ion selectivity and transport .

The protein belongs to a class of membrane transporters that often contain conserved metal-binding motifs critical for coordination and selectivity of specific metal ions. In many metal transporters, residues such as methionine, histidine, aspartate, and glutamate serve as coordination points for metal ions. These residues may form a selectivity filter that distinguishes between different divalent metals like iron, zinc, or manganese . Unlike the DMT1 in P. falciparum, which has been shown to contain specific residue substitutions that affect metal selectivity, the specific metal coordination residues in TC_0698 require further characterization to determine its preferential metals.

What are the optimal conditions for expressing recombinant TC_0698 protein?

The expression of recombinant TC_0698 is typically achieved in E. coli expression systems with an N-terminal His-tag to facilitate purification . Based on similar membrane protein expression protocols, the following methodology is recommended:

  • Expression System Selection: BL21(DE3) E. coli strain is preferred for membrane protein expression due to its reduced protease activity.

  • Induction Conditions: Use IPTG at 0.1-0.5 mM concentration with induction at lower temperatures (16-18°C) for 16-20 hours to enhance proper folding of membrane proteins.

  • Buffer Optimization: During purification, incorporate detergents suitable for membrane proteins, such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration.

  • Protein Stabilization: The recombinant protein should be stored in a buffer containing 6% trehalose at pH 8.0 as indicated in the product specifications . This helps maintain protein stability during freeze-thaw cycles.

For reconstitution after lyophilization, it's recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant for long-term storage at -20°C/-80°C .

What methods are most effective for studying TC_0698 function in vitro?

To investigate the function of TC_0698 as a metal transport protein, several complementary methodologies can be employed:

  • Metal Binding Assays: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can quantify binding affinities between TC_0698 and various metal ions.

  • Liposome Reconstitution Assays: Incorporate purified TC_0698 into liposomes loaded with fluorescent metal ion indicators to measure transport activity in a controlled environment.

  • Radioactive Metal Uptake: Use radioisotope-labeled metals (e.g., 55Fe, 65Zn) to track transport across membranes in reconstituted proteoliposomes or bacterial cells expressing TC_0698.

  • Site-Directed Mutagenesis: Modify predicted metal-coordinating residues to validate their role in transport function, similar to studies with other DMT proteins where metal-coordinating methionine mutations affected transport specificity .

  • Membrane Potential Measurements: If TC_0698 transport is coupled to proton gradients, techniques like voltage-sensitive dyes can measure changes in membrane potential during transport.

These methods should be used in combination to build a comprehensive understanding of TC_0698's transport mechanism, substrate specificity, and kinetic parameters.

What is the relationship between TC_0698 expression and metal availability in different host environments?

The expression of metal transport proteins often responds dynamically to environmental metal concentrations. For TC_0698, its expression may be regulated by metal-sensing transcription factors that respond to metal deficiency or excess in the host environment.

Based on studies of other bacterial metal transporters, researchers should investigate:

  • Transcriptional Regulation: Identify potential metal-responsive elements in the TC_0698 promoter region that might bind transcription factors sensitive to metal concentrations.

  • Expression Profiling: Use qRT-PCR to measure TC_0698 expression levels under varying metal conditions or in different host tissues with distinct metal availability profiles.

  • Reporter Constructs: Generate TC_0698 promoter-reporter fusions to visualize expression changes in response to environmental cues in real-time.

  • Host-Pathogen Interface Analysis: Study how host nutritional immunity (sequestration of essential metals) affects TC_0698 expression and bacterial survival.

A comparative analysis of TC_0698 expression in the gastrointestinal tract versus the genital tract environments could reveal whether differential metal availability drives expression patterns that correlate with tissue-specific colonization abilities observed with related proteins like TC_0668 .

How can researchers effectively analyze the membrane topology of TC_0698?

Understanding the membrane topology of TC_0698 is crucial for elucidating its transport mechanism. Several complementary experimental approaches can be employed:

  • In silico Prediction: Use membrane protein topology prediction algorithms (TMHMM, Phobius, etc.) as a starting point to predict transmembrane domains.

  • Cysteine Scanning Mutagenesis: Systematically replace residues with cysteine and use membrane-impermeable thiol-reactive reagents to determine which regions are accessible from different sides of the membrane.

  • Fluorescence Protease Protection Assay: Tag TC_0698 with fluorescent proteins at various positions and monitor fluorescence after protease treatment to determine which regions are protected by the membrane.

  • Epitope Insertion and Antibody Accessibility: Insert epitope tags at predicted loops and termini, then use antibodies to detect accessible regions in intact versus permeabilized cells.

  • Cryo-EM Analysis: For higher resolution structural analysis, purify the protein and perform cryo-electron microscopy, potentially in nanodiscs to maintain the membrane environment.

Combining these approaches would generate a comprehensive model of TC_0698's membrane topology and orientation, which is essential for understanding its transport mechanism and substrate interactions.

What are the key differences between TC_0698 and other bacterial metal transporters?

TC_0698 likely shares functional similarities with other bacterial metal transporters but may possess unique features adapted to the Chlamydia life cycle. A comparative analysis should focus on:

  • Sequence Homology: Alignment with other bacterial metal transporters reveals conserved and divergent regions that may indicate functional specialization.

  • Metal Selectivity Determinants: Examination of potential metal-coordinating residues can predict metal preferences compared to other transporters.

  • Transport Mechanism: Analysis of charged residues within transmembrane domains may indicate whether TC_0698 functions as a channel, carrier, or symporter/antiporter.

The table below compares key features of TC_0698 with other well-characterized bacterial metal transporters:

FeatureTC_0698 (C. muridarum)DMT1 (Eukaryotic)ZupT (E. coli)MntH (Bacterial)
Length293 amino acids ~550 amino acids~250 amino acids~400 amino acids
Predicted TMDsMultiple12 8-1011
Metal SpecificityTo be determinedFe²⁺, Mn²⁺, Co²⁺, Cd²⁺Zn²⁺, Fe²⁺, Co²⁺Mn²⁺, Fe²⁺
Energy CouplingUnknownH⁺ gradient UnknownH⁺ gradient
Key ResiduesTo be characterizedMet→Ser substitutions affect selectivity Conserved His, AspConserved Asp, Glu

Understanding these differences can help researchers tailor experimental approaches to characterize TC_0698's unique properties and evolutionary adaptations to Chlamydia's intracellular lifestyle.

How can TC_0698 be utilized in drug discovery targeting Chlamydia infections?

TC_0698, as a membrane protein involved in essential metal transport, represents a potential target for anti-chlamydial therapeutics. Researchers can leverage this protein in drug discovery through several approaches:

  • High-Throughput Screening: Develop assays measuring TC_0698 transport activity to screen chemical libraries for inhibitors. Fluorescence-based metal ion indicators incorporated into proteoliposomes containing TC_0698 can detect transport inhibition.

  • Structure-Based Drug Design: If structural data becomes available through crystallography or cryo-EM, perform in silico docking studies to identify compounds that may bind to critical regions of TC_0698.

  • Peptidomimetic Approaches: Design peptides that mimic natural substrates or interacting proteins but function as competitive inhibitors of TC_0698.

  • Metal Chelator Conjugates: Develop membrane-permeable chelators that can be transported by TC_0698 but subsequently sequester essential metals inside the bacterium.

  • Transport Mechanism Disruptors: Target energy coupling mechanisms if TC_0698 functions as a secondary active transporter dependent on ion gradients.

The effectiveness of these approaches could be evaluated using cell culture infection models with wild-type and TC_0698-deficient Chlamydia strains to confirm target specificity. Drug candidates should be assessed for their ability to reduce bacterial load, particularly in models simulating the gastrointestinal tract environment where metal acquisition may be crucial for colonization .

What methodologies are recommended for studying the interaction between TC_0698 and the host immune system?

Understanding how TC_0698 interacts with the host immune system is crucial for comprehending Chlamydia pathogenesis. Several methodological approaches are recommended:

  • Antigen Presentation Studies: Determine whether TC_0698 fragments are presented by infected cells to T-cells by isolating MHC complexes and identifying bound peptides using mass spectrometry.

  • Antibody Response Analysis: Develop ELISA assays using recombinant TC_0698 to measure antibody responses in infected hosts, potentially identifying immunodominant epitopes.

  • Pattern Recognition Receptor Activation: Test whether purified TC_0698 activates innate immune receptors like TLRs or NLRs using reporter cell lines expressing individual receptors.

  • Cytokine Profiling: Measure cytokine responses to TC_0698 in various immune cell populations using multiplex assays or flow cytometry.

  • TC_0698 Localization During Infection: Use immunofluorescence with anti-TC_0698 antibodies to determine whether the protein becomes exposed to the host cytosol during infection, potentially triggering cytosolic immune sensors.

  • Comparative Immunology in Different Tissues: Given the correlation between Chlamydia's ability to colonize the gastrointestinal tract and its pathogenicity in the genital tract , compare immune responses to TC_0698 in both tissue environments.

These studies would help determine whether TC_0698 serves as a pathogen-associated molecular pattern (PAMP) recognized by the immune system or if it helps Chlamydia evade immune detection through metal-dependent mechanisms.

What are the most promising future research directions for TC_0698?

Based on current knowledge and research gaps, several high-priority research directions for TC_0698 include:

  • Structural Characterization: Obtain high-resolution structures through crystallography or cryo-EM to understand the transport mechanism and substrate binding sites.

  • Metal Specificity Determination: Establish which metals are transported by TC_0698 and measure transport kinetics under various conditions.

  • In vivo Function: Generate TC_0698 knockout or knockdown strains of C. muridarum to determine its importance for growth, survival, and virulence in different host environments.

  • Transcriptional Regulation: Identify factors that control TC_0698 expression in response to environmental conditions, particularly metal availability.

  • Functional Comparison with TC_0668: Since TC_0668 affects gastrointestinal colonization and genital pathogenicity , determine whether TC_0698 functions in a similar or complementary pathway.

  • Therapeutic Targeting: Develop and test specific inhibitors of TC_0698 as potential anti-chlamydial agents.

  • Host-Pathogen Metal Competition: Investigate how TC_0698 functions within the context of nutritional immunity, where the host restricts metal availability to limit pathogen growth.

These research directions would significantly advance our understanding of TC_0698's role in Chlamydia biology and potentially reveal new strategies for therapeutic intervention against chlamydial infections.

How can researchers overcome challenges in working with membrane proteins like TC_0698?

Membrane proteins present unique experimental challenges. For TC_0698 research, consider these methodological approaches:

  • Expression Optimization:

    • Use specialized E. coli strains designed for membrane protein expression (C41, C43)

    • Employ fusion partners that enhance membrane protein folding and stability

    • Test multiple detergents and lipid environments for optimal protein stability

  • Functional Assays:

    • Develop whole-cell assays that measure metal uptake in bacteria expressing TC_0698

    • Use fluorescent metal sensors with proteoliposomes for activity measurements

    • Employ electrophysiology techniques to detect ion movement if appropriate

  • Structural Studies:

    • Consider nanodiscs or amphipols as alternatives to detergents for maintaining native-like environment

    • Use SAXS or negative-stain EM as intermediate steps before attempting cryo-EM

    • Explore protein engineering to improve stability and crystallizability

  • In vivo Studies:

    • Develop conditional expression systems for essential genes

    • Use tissue-specific infection models to assess function in relevant environments

    • Employ fluorescent metal sensors in infected cells to visualize metal dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.