Recombinant Chlamydia muridarum Putative zinc metalloprotease TC_0344 (TC_0344)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydia muridarum Putative Zinc Metalloprotease TC_0344 (TC_0344)

The protein Recombinant Chlamydia muridarum Putative zinc metalloprotease TC_0344 (TC_0344) is a protein derived from the bacterium Chlamydia muridarum. Characterization of TC_0344 is limited, but studies involving other metalloproteases and C. muridarum provide insight. Metalloproteases, like TC_0344, are zinc-dependent enzymes that degrade extracellular matrix components . C. muridarum is often utilized to model human female genital tract infections because intravaginal infections in mice resemble the infection process in humans .

Role of Metalloproteases in Chlamydia muridarum Infections

Matrix metalloproteinases (MMPs) are a family of host-derived enzymes that facilitate the turnover of extracellular matrix molecules . Studies indicate that MMPs are important in the pathogenesis of chlamydial infections .

  • MMPs and Infection: Studies have found that MMP expression is enhanced during Chlamydia muridarum urogenital tract infections in female mice .

  • MMP Inhibition: The inhibition of MMPs can protect against the development of hydrosalpinx, a marker of oviduct occlusion and infertility, by preventing the ascension of infection into the upper genital tract .

  • MMP-9 and Infection: Research indicates that MMP-9 contributes to the pathogenesis of chlamydial infection, potentially by amplifying inflammatory responses .

Zinc Metalloproteases: Structure and Function

Zinc metalloproteases are characterized by their ability to bind zinc ions, which are essential for their enzymatic activity . These proteases can cleave various substrates, including fibronectin and fibrinogen, which are components of the extracellular matrix .

  • Conserved Motifs: Zinc metalloproteases typically have a conserved HEXXH motif that is crucial for proteolytic activity. This motif is involved in zinc binding .

  • Substrate Specificity: Metalloproteases exhibit specificity in their activity, efficiently cleaving certain proteins while having limited effects on others .

Chlamydia muridarum and Immune Response

Chlamydia muridarum interacts with the host immune system, influencing the production of cytokines and chemokines .

  • TLR3 and IFN-β: C. muridarum infection induces the synthesis of interferon-beta (IFN-β) in murine oviduct epithelial cells, requiring functional Toll-like receptor 3 (TLR3) .

  • Matrix Metalloproteinases (MMPs): Enhanced expression of MMPs has been observed following murine chlamydial infection, suggesting their involvement in the host response .

  • MMP-9 and Inflammation: MMP-9 may amplify inflammatory responses during chlamydial infections .

Potential Therapeutic Interventions

Targeting Chlamydia infections can involve direct antibacterial approaches or modulation of the host immune response .

  • MMP Inhibitors: Chemical inhibitors of MMPs have shown promise in protecting against upper genital tract infection .

  • Antibacterial Compounds: Certain trifluoromethyl-pyridine compounds have demonstrated in vitro activity against Chlamydia trachomatis, suggesting potential therapeutic avenues .

  • Vaccination Strategies: Subunit vaccines based on T cell protein antigens have shown promise in protecting against Chlamydia muridarum infection in mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TC_0344; Putative zinc metalloprotease TC_0344
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
TC_0344
Target Protein Sequence
MTVIYFVLAALALGFLILIHELGHLLAAKAVGMTVESFSIGFGPALVRKKMGSIEYRIGA IPFGGYVRIKGMDRNDKEISEDREKTVYDIPGGFFSKSPWKRIFVLAAGPLANILVALFA FGILYFSGGRTKPFSEHTSIVGWAHPSLEQKGLRPGDRIFLCNGQVYSGNKMAFSSSLLD RKLSLQGEHPAYFSEAESFSLDVPFNPSLEGVPCLGASYLLYRGSEPLPEKSPLIDAGLS EGDRLVWMDGALVFSGVQVSQILNEKKAFLRIERQGKIVFVRQSRVLAGDLQLTSYFKNE LIDCQYEAGLKGKWASLYMLPYIINSDGFVESKINLLNTDQQSLDYHLELGDRIVAVDGI PVMSNADILRLVQDHRVSLIFQRMSSGQLSVLDQKAADKAFIDSYDMDDLLRVAGSVGEE REVSHLGEYRLVTRVQPKPWVHIYSEELLDKQRALASKFRDEQEKRYYLERIESEKQRIS LGIPLKDLAVQYNPAPLVLMGESISDSLRTVKALGSGRLSPQWLSGPVGIVRILHTGWSM GIPEALSWIGLISINLAVLNLLPIPVLDGGYILLCLWESVSRRRLNMRLIEKGLVPFMIL LILFFVFLTLQDLSRVFIG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression system is optimal for producing Recombinant Chlamydia muridarum Putative zinc metalloprotease TC_0344?

The optimal expression system for producing this recombinant protein is Escherichia coli. The current commercially available recombinant TC_0344 is produced in E. coli with an N-terminal His-tag to facilitate purification . When establishing your own expression system, consider the following methodological approach:

  • Clone the full-length gene (1-619aa) into an expression vector with a His-tag coding sequence

  • Transform into an E. coli expression strain optimized for recombinant protein production

  • Induce expression using IPTG or other appropriate inducers

  • Purify using nickel affinity chromatography, taking advantage of the His-tag

  • Confirm expression through SDS-PAGE analysis, aiming for purity greater than 90%

E. coli remains the preferred system for this protein due to its cost-effectiveness, scalability, and ability to produce sufficient quantities for research applications. Alternative expression systems such as insect cells may be considered if protein folding or post-translational modifications become critical factors in your specific research application .

What are the recommended storage and reconstitution protocols for TC_0344 protein?

Proper storage and reconstitution of the TC_0344 protein are critical for maintaining its structural integrity and biological activity. The recommended protocol is as follows:

Storage protocol:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Store the lyophilized powder at -20°C/-80°C

  • For long-term storage, add glycerol to a final concentration of 50% after reconstitution

  • Aliquot the glycerol-containing solution to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

Reconstitution protocol:

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution by gentle swirling, avoiding vigorous shaking

  • After reconstitution, the protein will be in Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Add glycerol (5-50% final concentration) for storage stability

It is crucial to note that repeated freeze-thaw cycles significantly reduce protein activity. A methodologically sound approach is to prepare multiple small aliquots of the reconstituted protein during initial preparation to minimize freeze-thaw cycles throughout your experimental timeline .

What methodological approaches are recommended for determining the enzymatic activity of TC_0344 as a zinc metalloprotease?

To determine the enzymatic activity of TC_0344 as a zinc metalloprotease, researchers should implement a multi-faceted approach:

  • Substrate specificity assay:

    • Test enzymatic activity using fluorogenic peptide substrates containing FRET pairs

    • Assess cleavage of different peptide sequences to determine substrate specificity

    • Include controls with known zinc metalloproteases (e.g., matrix metalloproteases) for comparative analysis

  • Inhibition studies:

    • Test sensitivity to metal chelators (EDTA, 1,10-phenanthroline) to confirm metal dependency

    • Evaluate inhibition with specific zinc metalloprotease inhibitors

    • Perform dose-response inhibition curves to determine IC50 values

  • Metal dependency verification:

    • Prepare metal-free enzyme through extensive dialysis against EDTA

    • Assess restoration of activity by adding back Zn2+ and other divalent cations (Mg2+, Ca2+)

    • Quantify metal content using atomic absorption spectroscopy or ICP-MS

  • Kinetic parameters determination:

    • Measure initial reaction velocities at various substrate concentrations

    • Calculate Km, Vmax, kcat using appropriate enzyme kinetic models

    • Determine optimal pH and temperature for enzymatic activity

When reporting enzymatic activity, express specific activity in terms of μmol substrate cleaved per minute per mg of protein under standardized conditions. This standardized approach facilitates comparison with other zinc metalloproteases and enables evaluation of the protein's catalytic efficiency .

How can researchers effectively design immunogenicity studies for TC_0344 in the context of Chlamydia muridarum infection models?

Designing effective immunogenicity studies for TC_0344 requires careful consideration of the following methodological elements:

  • Animal model selection:

    • Use female mice (BALB/c, C57BL/6, or C3H/HeN strains) for consistent immunological responses

    • Consider age (6-8 weeks) and housing conditions to minimize variability

    • Establish appropriate control groups (unimmunized, adjuvant-only, and irrelevant protein controls)

  • Immunization protocol design:

    • Compare different routes: intranasal (i.n.) versus intramuscular plus subcutaneous (i.m.+s.c.)

    • Test various adjuvant formulations to skew toward Th1 or Th2 responses:

      • For Th1 responses: CpG oligodeoxynucleotide (ODN) with Montanide ISA 720

      • For Th2 responses: Alum (aluminum hydroxide solution)

    • Establish immunization schedule with primary and booster doses at 2-week intervals

  • Immunological assessment:

    • Collect serum samples at regular intervals (pre-immunization and every 2 weeks post-immunization)

    • Monitor antibody responses using ELISA and protein microarray techniques

    • Assess T-cell responses through:

      • Antigen-specific T-cell proliferation assays

      • Cytokine profiling (IFN-γ, IL-4, IL-17) by ELISPOT or flow cytometry

      • Adoptive transfer experiments to determine protective efficacy of T cells

  • Challenge studies:

    • Challenge immunized animals with live C. muridarum 4-6 weeks after final immunization

    • Quantify bacterial burden at different time points post-challenge

    • Assess pathological changes in target tissues

    • Measure protection by comparing bacterial clearance rates between immunized and control groups

To determine if TC_0344 is an immunodominant antigen, researchers should evaluate the longevity of the immune response. Consider an antigen immunodominant if it elicits antibodies that persist for at least five non-consecutive time points or three consecutive time points over a 180-day post-immunization period .

What bioinformatic approaches can predict TC_0344 structural features and functional domains?

A comprehensive bioinformatic analysis of TC_0344 should employ multiple computational approaches to predict structural features and functional domains:

  • Primary sequence analysis:

    • Identify signal peptides using SignalP or PrediSi

    • Predict transmembrane domains using TMHMM or Phobius

    • Locate potential post-translational modification sites using NetOGlyc, NetNGlyc, and NetPhos

    • Analyze amino acid composition for hydrophobic regions and charge distribution

  • Secondary structure prediction:

    • Apply algorithms like PSIPRED, JPred, and GOR to predict α-helices, β-sheets, and coils

    • Use Coils server to identify potential coiled-coil regions

    • Predict disordered regions using IUPred or PONDR

  • Tertiary structure modeling:

    • Perform homology modeling using SWISS-MODEL or I-TASSER

    • When homology is limited, use ab initio modeling approaches like Rosetta

    • Validate predicted structures using PROCHECK and MolProbity

    • Visualize models using PyMOL or UCSF Chimera

  • Functional domain identification:

    • Search for conserved domains using InterProScan or the Conserved Domain Database

    • Identify zinc-binding motifs (HEXXH) characteristic of metalloproteases

    • Map surface-exposed epitopes using BepiPred and DiscoTope

    • Perform multiple sequence alignment with other metalloproteases to identify conserved catalytic residues

The bioinformatic analysis should particularly focus on locating the zinc-binding motif and catalytic domain, as these are critical for the metalloprotease activity of TC_0344. Additionally, identifying potential surface-exposed regions will guide epitope mapping studies for vaccine development .

What statistical methods should be applied when analyzing TC_0344 immunogenicity data from animal models?

When analyzing TC_0344 immunogenicity data from animal models, researchers should implement rigorous statistical approaches that account for the complexity and variability inherent in immunological experiments:

  • Descriptive statistics:

    • Calculate central tendency measures (mean, median) for immunological responses

    • Determine dispersion measures (standard deviation, interquartile range)

    • Assess data distribution characteristics (skewness, kurtosis)

    • Present data with appropriate error bars (standard error or 95% confidence intervals)

  • Inferential statistics for group comparisons:

    • For normally distributed data:

      • Use paired or unpaired t-tests for two-group comparisons

      • Apply one-way ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple group comparisons

    • For non-normally distributed data:

      • Use Mann-Whitney U test for two-group comparisons

      • Apply Kruskal-Wallis test with Dunn's post-hoc test for multiple groups

    • Set significance threshold at p<0.05 with appropriate adjustments for multiple comparisons

  • Longitudinal data analysis:

    • Use repeated measures ANOVA or mixed-effects models for time-course experiments

    • Apply area under the curve (AUC) analysis for comparing response magnitudes over time

    • Consider survival analysis techniques (Kaplan-Meier, Cox proportional hazards) for protection studies

  • Correlation and regression analysis:

    • Calculate Pearson or Spearman correlation coefficients between antibody titers and protection levels

    • Develop multivariate regression models to identify predictors of protection

    • Consider principal component analysis to reduce dimensionality of complex immunological datasets

When reporting statistical results, include exact p-values, confidence intervals, and effect sizes. Sample size calculations should be performed a priori based on expected effect sizes from preliminary data. Additionally, researchers should consider using power analysis to ensure adequate statistical power (typically 0.8 or greater) for detecting biologically meaningful differences .

How does TC_0344 compare to other known Chlamydia muridarum immunogenic proteins for vaccine development?

When comparing TC_0344 to other known C. muridarum immunogenic proteins for vaccine development, researchers should consider several critical factors:

  • Immunodominance comparison:
    Among the 36 immunodominant antigens identified in C. muridarum, several have demonstrated significant potential as vaccine candidates. These include TC0052 (MOMP), TC0268 (hypothetical protein), TC0512 (outer membrane protein), TC0727 (60-kDa outer membrane protein), and TC0816 (hypothetical protein). While TC_0344 is not specifically mentioned among the top immunodominant proteins in the available data, its characteristics as a zinc metalloprotease suggest it may have unique immunogenic properties that complement existing candidates .

  • Cellular localization advantages:
    Proteins with surface membrane localization (extracellular, outer membrane, and periplasmic) and those containing signal peptides are significantly enriched among reactive antigens. Well-established outer membrane proteins like MOMP (TC0052) and the Omp85 analog (TC0512) have shown superior immunogenicity. Researchers should determine TC_0344's cellular localization to assess its comparative potential .

  • Conservation across Chlamydia species:
    Antigens conserved across multiple Chlamydia species offer broader protection potential. Several type III secretion proteins, including TC0045 (SctC) and TC0848 (SctJ), have been studied for their vaccine potential due to their conservation among Gram-negative pathogenic bacteria. The conservation profile of TC_0344 across Chlamydia species should be established through comparative genomic analysis .

  • Immune response profile:
    Different antigens stimulate distinct immune response profiles. Some preferentially induce CD4+ T-cell responses, while others primarily generate antibody responses. The most promising vaccine candidates, such as TC0396 (IncA), TC0660 (amino acid ABC transporter), and TC0386 (60 kDa chaperonin), elicit both cellular and humoral responses. Researchers should characterize TC_0344's immune response profile and compare it with these established candidates .

Understanding these comparative aspects will help position TC_0344 within the broader landscape of Chlamydia vaccine development and determine whether it represents a novel, complementary, or redundant candidate relative to existing options.

What are the methodological considerations for incorporating TC_0344 into multi-antigen subunit vaccine formulations?

Incorporating TC_0344 into multi-antigen subunit vaccine formulations requires careful methodological consideration of several critical factors:

  • Antigen combination strategy:

    • Conduct systematic testing of TC_0344 with complementary antigens that target different aspects of the pathogen's life cycle

    • Consider combining TC_0344 with established immunodominant proteins such as TC0052 (MOMP), TC0512 (outer membrane protein), or TC0727 (60-kDa outer membrane protein)

    • Test both sequential and simultaneous administration protocols to identify potential synergistic or antagonistic effects

    • Evaluate fixed-ratio combinations versus separate administration at different anatomical sites

  • Adjuvant selection and optimization:

    • Test TC_0344 with different adjuvant systems to determine optimal formulation:

      • For Th1-biased responses: CpG oligodeoxynucleotide with Montanide ISA 720

      • For Th2-biased responses: Aluminum hydroxide (Alhydrogel)

      • For balanced responses: Oil-in-water emulsions or liposome-based adjuvants

    • Optimize adjuvant concentrations specifically for TC_0344 in the multi-antigen context

    • Assess stability of TC_0344 in the presence of different adjuvants

  • Delivery system considerations:

    • Evaluate protein-based delivery versus nucleic acid-based expression (DNA or mRNA vaccines)

    • Consider nanoparticle encapsulation to enhance stability and immunogenicity

    • Test mucosal delivery systems for intranasal administration

    • Assess controlled-release formulations for prolonged antigen presentation

  • Compatibility and stability assessment:

    • Perform accelerated stability studies of TC_0344 in combination with other antigens

    • Assess potential physical interactions between antigens (aggregation, precipitation)

    • Evaluate chemical compatibility in the final formulation

    • Develop analytical methods to quantify each antigen individually within the multi-component formulation

    • Determine shelf-life under various storage conditions

The successful incorporation of TC_0344 into a multi-antigen formulation will ultimately depend on demonstrating that its inclusion provides additive or synergistic protection compared to formulations lacking this specific antigen. Systematic testing using the methodological approaches outlined above will help determine the optimal composition for advancing to clinical evaluation .

What techniques can identify potential host cell substrates for TC_0344 metalloprotease activity?

Identifying potential host cell substrates for TC_0344 metalloprotease activity requires a systematic approach combining multiple complementary techniques:

  • Proteomic identification of cleaved proteins:

    • Incubate purified TC_0344 with host cell lysates or enriched subcellular fractions

    • Analyze reaction products using differential gel electrophoresis (DIGE)

    • Identify cleaved proteins through mass spectrometry:

      • Use techniques like MALDI-TOF MS or LC-MS/MS

      • Apply N-terminal labeling strategies (TAILS, COFRADIC) to identify specific cleavage sites

    • Compare cleavage patterns with known zinc metalloprotease substrates

  • Protein microarray screening:

    • Generate protein microarrays containing potential host target proteins

    • Incubate arrays with active TC_0344 and control (inactive mutant)

    • Detect substrate cleavage using antibodies against N-terminal or C-terminal epitopes

    • Validate hits through secondary biochemical assays

    • Consider using arrays containing proteins from different cellular compartments to narrow down potential substrate locations

  • Cell-based substrate identification:

    • Express TC_0344 in mammalian cells using inducible expression systems

    • Apply quantitative proteomics to identify proteins with altered abundance

    • Use SILAC or TMT labeling for improved quantification accuracy

    • Monitor cellular phenotypes associated with TC_0344 expression

    • Employ proximity-based labeling techniques (BioID, APEX) to identify proteins in close proximity to TC_0344 within cells

  • Bioinformatic prediction and validation:

    • Analyze substrate specificity of related zinc metalloproteases

    • Use machine learning algorithms to predict potential cleavage sites in host proteins

    • Perform in silico docking studies between TC_0344 models and candidate substrates

    • Validate predictions through in vitro cleavage assays with synthetic peptides containing predicted sites

The integration of data from these complementary approaches will provide a comprehensive understanding of TC_0344's substrate specificity and potential role in Chlamydia muridarum pathogenesis. Particular attention should be paid to host proteins involved in immune response, cell signaling, and membrane integrity, as these are common targets for bacterial virulence factors .

What quality control parameters should be monitored when working with recombinant TC_0344 protein?

Researchers working with recombinant TC_0344 protein should implement a comprehensive quality control protocol that monitors the following parameters:

  • Purity assessment:

    • Perform SDS-PAGE analysis with Coomassie or silver staining to verify protein purity

    • Aim for purity greater than 90% as the minimum acceptable threshold

    • Use densitometry to quantify the percentage of TC_0344 relative to contaminants

    • Consider high-resolution techniques like capillary electrophoresis for more precise purity determination

  • Identity confirmation:

    • Verify protein identity through Western blot using:

      • Anti-His antibodies to detect the N-terminal tag

      • Protein-specific antibodies when available

    • Perform peptide mass fingerprinting by mass spectrometry

    • Sequence the N-terminus using Edman degradation to confirm correct processing

  • Structural integrity evaluation:

    • Assess secondary structure using circular dichroism (CD) spectroscopy

    • Analyze thermal stability through differential scanning fluorimetry (DSF)

    • Monitor aggregation state using dynamic light scattering (DLS)

    • Evaluate folding using intrinsic tryptophan fluorescence spectroscopy

  • Functional validation:

    • Develop activity assays specific to zinc metalloproteases

    • Monitor enzymatic activity using appropriate fluorogenic substrates

    • Measure zinc content using atomic absorption spectroscopy

    • Test activity in the presence of specific inhibitors to confirm mechanism

  • Storage stability monitoring:

    • Implement accelerated stability testing at various temperatures

    • Assess activity retention after multiple freeze-thaw cycles

    • Monitor changes in solubility and aggregation over time

    • Determine optimal buffer conditions for long-term storage

Maintaining detailed records of these quality control parameters for each batch of TC_0344 is essential for ensuring experimental reproducibility. Researchers should establish acceptance criteria for each parameter based on their specific experimental requirements and reject batches that fail to meet these standards .

How can researchers troubleshoot expression and purification challenges specific to TC_0344?

Researchers may encounter several challenges when expressing and purifying TC_0344. The following methodological troubleshooting approaches address common issues:

  • Low expression yield:

    • Optimize codon usage for E. coli by synthesizing a codon-optimized gene

    • Test multiple E. coli expression strains (BL21(DE3), Rosetta, Arctic Express)

    • Vary induction conditions (IPTG concentration, temperature, duration)

    • Consider using enriched media formulations (TB, 2xYT instead of LB)

    • Evaluate different promoter systems (T7, tac, arabinose-inducible)

  • Inclusion body formation:

    • Lower induction temperature to 16-18°C and extend expression time

    • Reduce inducer concentration for slower protein production

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Add solubility-enhancing fusion tags (SUMO, MBP, TrxA) instead of just His-tag

    • If inclusion bodies persist, develop refolding protocols using gradual dialysis

  • Protein degradation:

    • Add protease inhibitors during all purification steps

    • Use protease-deficient E. coli strains

    • Maintain samples at 4°C throughout purification

    • Minimize time between cell lysis and purification

    • Test multiple buffer systems to identify optimal pH stability range

  • Purification challenges:

    • Optimize imidazole concentration in binding and washing buffers

    • Consider tandem purification (His-tag followed by ion exchange or size exclusion)

    • Test different resin types for His-tag purification (Ni-NTA, TALON, HisTrap)

    • Evaluate on-column refolding for problematic preparations

    • Troubleshoot by analyzing all fractions by SDS-PAGE to locate target protein

  • Solubility and stability issues:

    • Screen multiple buffer compositions (pH, salt concentration, additives)

    • Test protein stabilizers (glycerol, trehalose, arginine)

    • Evaluate the effect of reducing agents (DTT, TCEP)

    • Consider the addition of zinc or other metal ions for stabilization

    • Optimize protein concentration to prevent aggregation

For particularly challenging cases, consider expressing smaller domains of TC_0344 separately rather than the full-length protein. The catalytic domain may express with better solubility than the complete protein while retaining the enzymatic activity necessary for functional studies .

What are the current research gaps regarding TC_0344 function in Chlamydia muridarum pathogenesis?

Despite progress in characterizing TC_0344, several significant research gaps remain regarding its function in Chlamydia muridarum pathogenesis:

Addressing these research gaps would significantly advance our understanding of TC_0344's biological relevance and potentially identify new targets for therapeutic intervention against Chlamydia infections.

What emerging technologies could enhance TC_0344 research in the next five years?

Several emerging technologies are poised to significantly advance TC_0344 research over the next five years:

  • CRISPR-Cas9 genome editing in Chlamydia:
    Recent breakthroughs in applying CRISPR-Cas9 technology to previously intractable bacterial species will enable precise genetic manipulation of Chlamydia. This will allow:

    • Creation of TC_0344 knockout mutants to directly assess its role in pathogenesis

    • Introduction of point mutations to identify critical catalytic residues

    • Development of reporter fusions to track TC_0344 expression and localization in real-time

    • Conditional expression systems to study TC_0344 function at specific stages of infection

  • Advanced structural biology techniques:

    • Cryo-electron microscopy (cryo-EM) at near-atomic resolution will enable visualization of TC_0344 structure without crystallization

    • AlphaFold2 and other AI-powered structure prediction algorithms will provide increasingly accurate models of TC_0344 and its interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) will reveal dynamic aspects of TC_0344 structure and substrate binding

    • Integrative structural biology approaches combining multiple data types will yield comprehensive structural models

  • Single-cell technologies:

    • Single-cell RNA-seq will reveal host cell transcriptional responses to TC_0344 exposure

    • Mass cytometry (CyTOF) will enable detailed characterization of immune cell subsets responding to TC_0344

    • Single-cell proteomics will identify cell-specific changes in protein abundance following TC_0344 exposure

    • Spatial transcriptomics will map TC_0344-induced changes in tissue architecture during infection

  • Advanced vaccine delivery platforms:

    • mRNA vaccine technology will enable efficient delivery of TC_0344 antigens

    • Self-amplifying RNA platforms will enhance immunogenicity with lower antigen doses

    • Nanoparticle-based delivery systems will improve antigen stability and trafficking to lymphoid tissues

    • Computational vaccinology will predict optimal epitope combinations including TC_0344-derived sequences

  • Organoid and microphysiological systems:

    • Epithelial organoids will provide physiologically relevant models to study TC_0344 function

    • Organ-on-chip technology will enable analysis of TC_0344 effects in complex tissue environments

    • Immune system organoids will allow assessment of TC_0344 immunogenicity in human-derived systems

    • These systems will reduce reliance on animal models while providing human-relevant data

These emerging technologies will collectively accelerate discovery by providing new tools to address the fundamental questions surrounding TC_0344's structure, function, and potential as a vaccine candidate or therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.