Recombinant Chlamydia muridarum Uncharacterized protein TC_0206 (TC_0206)

Shipped with Ice Packs
In Stock

Description

Research Context and Functional Insights

TC_0206 is annotated as a hypothetical protein, with limited functional data in public databases. Key findings from transposon mutagenesis studies in C. muridarum include:

Transposon Mutagenesis Analysis

A transposon insertion in TC_0206 (UWCM001) resulted in a mutant strain with a truncated protein (86% predicted translated length) . While the study focused on genome-wide mutagenesis, no phenotypic or functional data were reported for TC_0206, highlighting the need for targeted investigations.

Mutant StrainInsertion SitePredicted Impact
UWCM001TA dinucleotide (genomic location: 242,824>25)Truncation at 3′ end, 86% translated protein retained

Applications in Research

Recombinant TC_0206 is primarily used in:

  • Antibody Production: As an immunogen for generating TC_0206-specific antibodies to study protein localization or interactions.

  • Pathogenesis Studies: To explore its role in C. muridarum infection biology, particularly in the context of host-pathogen interactions.

  • Diagnostic Development: Potential use in assays to detect C. muridarum-specific immune responses.

Challenges and Gaps in Knowledge

  • Functional Ambiguity: No studies have directly linked TC_0206 to specific biochemical or virulence-related pathways.

  • Structural Data: The partial sequence and lack of crystallographic or NMR data hinder mechanistic insights.

  • Species-Specificity: Unlike C. trachomatis proteins (e.g., MOMP), TC_0206’s role in C. muridarum pathogenesis remains undefined .

Comparative Analysis with Related Proteins

While TC_0206 lacks characterized homologs, other C. muridarum proteins, such as TC_0306 (Q9PL02), have been studied in greater detail. For example:

ProteinExpression SystemTagPurityFunction
TC_0206BaculovirusN/A>85%Hypothetical
TC_0306E. coliHis-tag>90%Uncharacterized

Both proteins are classified as uncharacterized, underscoring the need for comparative genomic and functional studies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly shipped with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
TC_0206; Uncharacterized protein TC_0206
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
TC_0206
Target Protein Sequence
MGLYDRDYTQDSRLPGTFSSRVYGWMTAGLAVTALTSLGLYATGAYRTLFSLWWVWCFAT LGVSFYIQAQIQKLSVPAVMGLFLAYSVLEGMFFGTMVPVYAAQFGGGIVWAAFGSAAVI FGLSAAYGAFTKSDLTQIHRILMLALIGLMVISLGFLVVSLFTPMPLMYLLICYLGLIIF VGLTVVDAQSIRRVARSVGDHGDLSYKLSLIMALQMYCNVIMIFWYLLQIFASSDKRR
Uniprot No.

Target Background

Database Links
Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TC_0206 and why is it significant for Chlamydia research?

TC_0206 is an uncharacterized protein in Chlamydia muridarum, a mouse-adapted Chlamydia species widely used for in vivo investigations of chlamydial pathogenesis. While specific functions remain unknown, studying such uncharacterized proteins is crucial for understanding C. muridarum biology and pathogenicity. C. muridarum serves as an excellent model system for examining roles of genes in chlamydial in vivo biology, as it recapitulates immune mediators of protection and pathology observed in human infections with C. trachomatis . Characterizing TC_0206 may reveal insights applicable to human Chlamydia infections and potential therapeutic targets.

How does TC_0206 relate to other characterized proteins in C. muridarum?

TC_0206 belongs to the approximately 1,000 genes in the chlamydial genome, many of which remain functionally uncharacterized due to historical challenges with genetic manipulation of Chlamydia . Unlike characterized proteins such as TC0668 (identified as a chromosome-encoded urogenital pathogenicity factor ) or polymorphic membrane proteins (Pmps), TC_0206's genomic context, conservation across Chlamydia species, and potential role in infection or pathogenesis require further investigation. Phylogenetic analysis comparing TC_0206 with other C. muridarum proteins would be an important first step to understanding potential functional relationships.

What expression systems are suitable for recombinant TC_0206 production?

For recombinant TC_0206 production, several expression systems can be considered:

Expression SystemAdvantagesLimitationsOptimization Considerations
E. coliHigh yield, rapid growth, established protocolsMay lack proper folding or post-translational modificationsCodon optimization, fusion tags, reduced temperature
Mammalian cellsNative-like modifications, proper foldingLower yield, higher costTransient vs. stable expression, signal peptide optimization
Cell-free systemsRapid production, suitable for toxic proteinsLimited scale, higher costBuffer optimization, chaperone addition

The choice depends on research goals - structural studies may benefit from E. coli expression with purification tags, while functional studies might require mammalian expression to preserve native conformation and modifications.

How can transposon mutagenesis be applied to study TC_0206 function?

Transposon mutagenesis can be effectively applied to study TC_0206 using the Himar transposon system successfully developed for C. muridarum . This approach generates random, single-gene insertion mutations fixed within the chromosome that are easily identified by PCR . To specifically study TC_0206:

  • Generate a TC_0206 transposon insertion mutant using pCMC5M vector (containing gfp-cat for chloramphenicol selection and GFP screening)

  • Confirm insertion location by whole-genome sequencing to verify genotype

  • Characterize the mutant through:

    • In vitro growth analyses in cell culture to examine inclusion morphology and development

    • Infectivity assays comparing with wild-type strains

    • In vivo phenotypic assessment in mouse infection models

    • Complementation studies to confirm phenotype specificity

This method has proven successful for characterizing other C. muridarum genes, including glycogen synthesis (glgB) and polymorphic membrane proteins (pmpI, pmpA, pmpD) .

What approaches are recommended for validating antibodies against TC_0206?

Antibody validation for an uncharacterized protein like TC_0206 requires multiple complementary approaches:

  • Primary Validation:

    • Western blot against recombinant TC_0206 to confirm specificity

    • Testing against C. muridarum lysates to confirm detection at expected molecular weight

    • Parallel testing against TC_0206 knockout strains as negative controls

  • Secondary Validation:

    • Immunofluorescence microscopy to determine subcellular localization

    • Immunoprecipitation followed by mass spectrometry

    • Cross-reactivity assessment against related Chlamydia species proteins

  • Functional Validation:

    • Neutralization assays if TC_0206 is accessible on the bacterial surface

    • Epitope mapping to ensure recognition of multiple protein regions

    • Validation across different developmental forms (elementary bodies vs. reticulate bodies)

The reliability of antibody-based studies is particularly important when studying uncharacterized proteins, as results guide subsequent functional hypotheses.

How can researchers determine if TC_0206 is essential for C. muridarum viability?

Determining essentiality of TC_0206 requires multiple experimental approaches:

  • Transposon Mutagenesis Screening: Attempt to generate TC_0206 mutants using transposon mutagenesis . Inability to isolate viable mutants may suggest essentiality, though negative results require careful interpretation.

  • Conditional Expression Systems: Develop inducible expression systems where TC_0206 expression can be modulated, allowing assessment of viability under varying expression levels.

  • Complementation Testing: If TC_0206 mutants are obtained, perform complementation with wild-type gene to confirm phenotype reversibility.

  • Growth Kinetics Analysis: Similar to studies with TC0668 null mutants, compare intracellular growth curves between wild-type and TC_0206 mutants (if viable) to assess impact on developmental cycle .

  • Comparative Genomics: Analyze conservation of TC_0206 across Chlamydia species and related genera, as highly conserved genes often have essential functions.

A multiplexed approach is necessary as single methods may yield ambiguous results. For example, the TC0668 null mutant showed no obvious effect on in vitro fitness despite being important for pathogenicity in vivo .

What host-pathogen interaction studies might reveal TC_0206 function?

Host-pathogen interaction studies for TC_0206 should include:

  • Secretion Analysis: Determine if TC_0206 is secreted into host cytosol or remains bacterium-associated using fractionation approaches.

  • Interactome Mapping: Identify host cell binding partners through:

    • Yeast two-hybrid screening

    • Proximity labeling methods (BioID, APEX)

    • Co-immunoprecipitation with mass spectrometry

  • Transcriptional Profiling: Compare host cell responses to wild-type versus TC_0206-deficient infections using RNA-seq.

  • Cellular Pathway Analysis: Assess impact on specific cellular processes:

    • Cytoskeletal rearrangements

    • Inflammatory cytokine production

    • Cell death pathways

    • Nutrient acquisition

  • In vivo Infection Studies: Similar to TC0668 studies , compare wild-type and TC_0206-deficient strains in mouse models, assessing bacterial load, inflammatory markers, and tissue pathology.

These studies would help position TC_0206 within the context of known chlamydial virulence mechanisms and could reveal whether it functions similarly to established pathogenicity factors like TC0668 .

What mouse infection models are appropriate for assessing TC_0206's role in pathogenesis?

The female mouse genital tract infection model represents the most appropriate system for assessing TC_0206's role in pathogenesis:

  • Model Selection: C. muridarum infection in female mice recapitulates immune mediators of protection and fallopian tube pathology observed with severe C. trachomatis infection in women . This model produces oviduct scarring, fibrosis, and hydrosalpinx, providing a robust system for vaccine and pathogenesis testing.

  • Infection Protocol:

    • Intravaginal inoculation with wild-type and TC_0206 mutant strains

    • Transcervical inoculation may be considered for direct upper genital tract assessment

  • Assessment Parameters:

    • Infection Course: Monitor vaginal shedding for 4-5 weeks

    • Upper Tract Disease: Evaluate oviduct inflammation, hydrosalpinx development, and tissue pathology

    • Immune Response Profiling: Measure CT-specific IFNγ+ CD4 T cells, which correlate with protection from reinfection

  • Male Mouse Model: Consider parallel studies in male mice, as male-to-female sexual transmission models have gained focus in recent years .

  • Comparative Analysis: Compare pathogenicity profiles with known attenuated strains like the TC0668 null mutant, which exhibits normal lower genital tract infection but reduced upper tract pathology .

Based on studies with other C. muridarum proteins, TC_0206 could potentially influence either bacterial survival in the genital tract or specifically modify inflammatory responses leading to pathology.

How do researchers reconcile differences between in vitro and in vivo phenotypes for C. muridarum protein mutants?

Reconciling in vitro and in vivo phenotypes requires systematic investigation:

  • Documented Precedents: Consider that proteins like TC0668 show no obvious effects on in vitro fitness yet are significant pathogenicity factors in vivo . This suggests TC_0206 could similarly influence pathogenesis without affecting basic growth.

  • Microenvironment Analysis:

    • Examine protein function under conditions mimicking in vivo microenvironments (nutrient limitation, oxygen tension, pH variation)

    • Test growth in primary cells versus cell lines

    • Evaluate behavior under immune pressure (IFNγ, NO)

  • Temporal Considerations:

    • Assess protein expression across developmental cycle stages

    • Determine if the protein functions during specific infection phases (attachment, entry, intracellular development)

  • Host Factor Interactions:

    • Investigate if host-specific factors present in vivo but absent in vitro explain phenotypic differences

    • Consider species specificity, as C. muridarum is adapted to murine hosts

  • Multiomics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from both settings

    • Identify differentially regulated pathways that might explain phenotypic discrepancies

Understanding these differences is critical, as in vitro systems alone may fail to reveal important pathogenicity factors like TC0668 .

How might TC_0206 characterization contribute to vaccine development against C. trachomatis?

TC_0206 characterization could impact C. trachomatis vaccine development in several ways:

  • Antigen Potential Assessment:

    • Determine conservation between C. muridarum TC_0206 and C. trachomatis homologs

    • Evaluate immunogenicity in mouse models using purified recombinant protein

    • Assess protective immunity against challenge with live bacteria

  • Correlates of Immunity:

    • Analyze if TC_0206-specific immune responses correlate with protection

    • Determine which immune components (antibodies, CD4+ T cells, CD8+ T cells) recognize TC_0206

    • Studies show CD4+ T cells producing IFNγ are particularly important for chlamydial clearance and protection

  • Adjuvant Selection:

    • Test TC_0206 with different adjuvant formulations

    • Evaluate cellular versus humoral immune responses generated

  • Attenuation Platform:

    • If TC_0206 affects pathogenesis but not bacterial viability, TC_0206 mutants might serve as live-attenuated vaccine candidates

    • This approach would parallel studies of other attenuated C. muridarum strains

  • Translational Relevance:

    • Determine if TC_0206 antibodies are produced during natural human infections

    • Assess if TC_0206 responses correlate with disease outcomes in human studies

Understanding TC_0206's role could contribute to broader vaccine development efforts that aim to prevent both infection and upper genital tract pathology .

What are the most promising techniques for resolving contradictory results in TC_0206 functional studies?

Resolving contradictory results in TC_0206 functional studies requires:

  • Standardization Approaches:

    • Establish reference materials (antibodies, recombinant proteins, bacterial strains)

    • Develop detailed protocols with critical parameters identified

    • Use multiple bacterial isolates to account for strain variation

  • Methodological Triangulation:

    • Apply multiple independent techniques to address the same question

    • Combine genetic, biochemical, and immunological approaches

    • Utilize both in vitro and in vivo systems

  • Advanced Genetic Approaches:

    • Generate clean genetic knockouts using newly developed tools for Chlamydia

    • Create complemented strains with controlled expression levels

    • Use domain-specific mutations to identify critical functional regions

  • Collaborative Cross-Validation:

    • Implement multi-laboratory testing of key findings

    • Share materials between research groups

    • Establish testing pipelines with standardized readouts

  • Systems Biology Integration:

    • Place contradictory findings in broader context using network analyses

    • Identify condition-specific or temporal factors that might explain divergent results

    • Model protein function across different experimental systems

This systematic approach would help establish consensus on TC_0206 function while acknowledging the complexity of chlamydial biology and experimental variability.

What are the major technical hurdles in expressing and purifying TC_0206 for structural studies?

Major technical hurdles for TC_0206 structural studies include:

  • Solubility Challenges:

    • Membrane association may complicate solubilization

    • Protein aggregation during overexpression

    • Solution: Test multiple detergents, fusion partners (MBP, SUMO), and expression conditions

  • Post-Translational Modifications:

    • Bacterial expression systems may lack necessary modifications

    • Solution: Consider eukaryotic expression or site-directed mutagenesis of modification sites

  • Structural Stability:

    • Uncharacterized proteins often have unknown stability profiles

    • Solution: Perform thermal shift assays to identify stabilizing buffer conditions

  • Crystallization Barriers:

    • Intrinsically disordered regions may prevent crystallization

    • Solution: Use limited proteolysis to identify stable domains

  • Expression Yield Optimization:

    • Codon optimization for expression host

    • Autoregulation effects that limit expression levels

    • Solution: Screen multiple expression constructs with varying tags and truncations

The approach should be informed by computational predictions of TC_0206 structure and potential functions, which could guide construct design and expression strategy.

How can researchers optimize detection of protein-protein interactions involving TC_0206?

Optimizing protein-protein interaction detection for TC_0206 requires:

  • Sample Preparation Considerations:

    • Crosslinking optimization to capture transient interactions

    • Native extraction conditions to preserve physiological complexes

    • Developmental cycle timing to capture stage-specific interactions

  • Methodological Diversity:

    MethodAdvantagesLimitationsOptimization for TC_0206
    Co-immunoprecipitationPreserves native complexesRequires specific antibodiesUse epitope tags if antibodies unavailable
    Proximity labeling (BioID)Captures transient interactionsRequires genetic manipulationExpress BioID fusion in Chlamydia
    Yeast two-hybridHigh-throughput screeningHigh false positive rateScreen against human and chlamydial libraries
    Pull-down assaysDirect binding assessmentMay miss weak interactionsOptimize buffer conditions
    FRET/BRETLive-cell detectionComplex setupCareful control design
  • Confirmation Strategies:

    • Reverse co-immunoprecipitation to confirm directionality

    • Functional assays to validate biological relevance

    • Mutational analysis of interaction interfaces

  • Data Integration:

    • Compare results across multiple methods

    • Use computational predictions to prioritize candidate interactions

    • Connect to phenotypic data from genetic studies

These approaches should be used in combination, as each method has specific strengths and limitations when studying bacterial proteins like TC_0206.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.