Recombinant Chlamydia muridarum Uncharacterized protein TC_0306 (TC_0306)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TC_0306; Uncharacterized protein TC_0306
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
TC_0306
Target Protein Sequence
MYPVEYPPPLYSSCKHILSLTAKQLKTKAFVVFSASLSLIIGLITGCCLLFASPPAFITS GICLALLVSVISFFGCRKLIPYGIQRLISYTKSLPALSDSLIDFLKTESTSISSLLPDPK LKNCFKGTSSEYKKFFFDHPETLLSSAFMDWTPQIGPSAPQQTKTIVLSHYCLPFSLTLS TLDFETLHTYIVKSNKLRCHVGYAHQLPPANPVIRQARQGVLQQLYNTGTETFFIPIQES ALLQQEELFKTLFRHYVQIIERNLSSRVLLLEPLKTPVHTHKARTLESLALFCALEYLCY TTLGDWGTKELDPTPPLDYKDFFTILIKKQCPASNMRISSPARPMNATKLTTIVLSGLEE EDKLGLLGQMQPFLFTAEIAHPQRFEATLIQNVLDDIA
Uniprot No.

Target Background

Database Links
Protein Families
Chlamydial CPn_0129/CT_036/TC_0306 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why is Chlamydia muridarum important as a model organism?

Chlamydia muridarum serves as a critical mouse-adapted model organism for studying chlamydial infections, particularly those caused by C. trachomatis in humans . This organism allows researchers to establish murine models of female upper genital tract infection, providing valuable insights into chlamydial pathogenesis that would be difficult to obtain through human studies . The use of C. muridarum enables in vivo investigations of immune responses, infection dynamics, and potential vaccine candidates, making it an essential tool for translational chlamydial research .

What methodologies have been developed for genetic manipulation of TC_0306?

Recent advances in genetic manipulation of Chlamydia have overcome historical challenges in functional genetic characterization. A transposon mutagenesis system has been developed specifically for C. muridarum, building on pioneering work with C. trachomatis . This system has successfully generated a library of 33 mutants containing stable single or double transposon insertions . For TC_0306 specifically, researchers can employ:

  • Transposon-based insertional mutagenesis to disrupt gene function

  • Selection of mutants using chloramphenicol resistance and GFP expression markers

  • Vector systems like pCMC5M that allow for selection of C. muridarum mutants

This genetic manipulation toolkit facilitates in-depth functional characterization of TC_0306 and other genes among the approximately 1,000 genes in chlamydial genomes .

How does TC_0306 compare to other virulence-associated proteins in Chlamydia?

While TC_0306 remains uncharacterized, comparison with other chlamydial proteins provides valuable context. For example, TC0668 is a hypothetical chromosomal virulence protein involved in upper genital tract pathogenesis in C. muridarum . When mice are infected with a TC0668-mutant strain, they exhibit less pathological damage in the upper genital tract compared to wild-type infection .

Similar functional studies could be conducted with TC_0306 to determine if it plays a role in virulence. Research approaches might include:

  • Creating isogenic TC_0306 mutant strains

  • Comparing infection outcomes between wild-type and mutant strains

  • Analyzing differential host cell responses using proteomics approaches like iTRAQ (isobaric tags for relative and absolute quantitation)

Such comparative analyses would help position TC_0306 within the broader context of chlamydial virulence factors.

What proteomics approaches can be used to study TC_0306's potential role in host-pathogen interactions?

iTRAQ-based quantitative proteomics has proven valuable for studying chlamydial proteins and their effects on host cells . This methodology could be applied to understand TC_0306's function by:

  • Comparing host cell protein expression profiles between cells infected with wild-type C. muridarum versus a TC_0306 mutant strain

  • Identifying differentially expressed proteins at various time points post-infection (e.g., 6, 12, 18, and 24 hours)

  • Using Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analyses to categorize affected proteins

  • Creating protein-protein interaction networks to visualize potential pathways influenced by TC_0306

This approach has successfully identified proteins involved in inflammatory responses, fibrosis, metabolic processes, and signaling pathways like PI3K/Akt and NF-κB during chlamydial infection .

What expression systems are optimal for producing recombinant TC_0306?

Based on current research, E. coli has been successfully used as an expression host for recombinant TC_0306 . When designing an expression strategy, researchers should consider:

  • Vector selection: Vectors incorporating an N-terminal His-tag have been effective

  • Expression conditions: Optimizing temperature, inducer concentration, and induction duration

  • Codon optimization: Adapting the chlamydial gene sequence for efficient expression in E. coli

  • Protein solubility: Addressing potential issues with hydrophobic regions through solubility-enhancing tags or membrane-mimicking environments

The recombinant protein is typically expressed as the full-length protein (amino acids 1-398) fused to an N-terminal His-tag, facilitating subsequent purification steps .

What purification strategies work best for recombinant TC_0306?

Purification of recombinant TC_0306 typically follows these methodological steps:

  • Initial affinity chromatography: For His-tagged TC_0306, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

  • Buffer optimization: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been reported as effective

  • Storage consideration: Aliquoting with 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Quality assessment: SDS-PAGE analysis confirming purity greater than 90%

For handling the purified protein:

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

This systematic approach ensures high-quality protein suitable for downstream applications.

What challenges might researchers encounter when working with recombinant TC_0306 and how can they be addressed?

Several methodological challenges may arise when working with TC_0306:

  • Solubility issues: If TC_0306 contains transmembrane domains or hydrophobic regions, it may exhibit limited solubility.

    • Solution: Use detergents, lipid nanodiscs, or fusion partners that enhance solubility.

  • Proper folding: As an uncharacterized protein, assessing correct folding can be difficult.

    • Solution: Employ biophysical techniques like circular dichroism spectroscopy or thermal shift assays to evaluate structural integrity.

  • Functional assessment: Without known function, validating activity is challenging.

    • Solution: Develop binding assays with potential interaction partners or evaluate effects on host cells when added exogenously.

  • Stability concerns: The protein may be prone to aggregation or degradation.

    • Solution: Optimize buffer conditions with stabilizing additives and determine optimal storage conditions through stability studies .

How can recombinant TC_0306 potentially be used in vaccine development?

While TC_0306's specific function remains uncharacterized, insights from related chlamydial protein research suggest potential applications in vaccine development:

  • Encapsulation strategies: Similar to other chlamydial proteins, TC_0306 could be encapsulated in extended-releasing PLGA (poly(lactic-co-glycolic acid)) nanoparticles for controlled antigen delivery .

  • Immune response evaluation: Following immunization with TC_0306-based vaccines, researchers should assess:

    • Chlamydia-specific T-cell proliferation

    • Development of memory (CD44+CD62L+) and effector (CD44+CD62L-) T-cells

    • Production of Th1 cytokines (IFN-γ and IL-2)

  • Challenge studies: Vaccine efficacy can be evaluated through challenge and re-challenge experiments, measuring bacterial burden through inclusion-forming units (IFU) counts and assessing upper genital tract pathology .

The development of TC_0306 as a vaccine component would benefit from both subcutaneous (SC) and intranasal (IN) immunization evaluation, as these routes have shown differential efficacy with other chlamydial antigens .

How might structural studies of TC_0306 inform therapeutic development?

Structural characterization of TC_0306 could significantly advance therapeutic strategies:

  • Structural determination techniques:

    • X-ray crystallography of purified recombinant protein

    • Cryo-electron microscopy for membrane-associated conformations

    • NMR spectroscopy for dynamic regions

  • Structure-function relationships:

    • Identifying key domains for chlamydial lifecycle functions

    • Mapping potential interaction surfaces with host proteins

    • Determining membrane-associating regions

  • Drug target assessment:

    • Evaluating druggable pockets or interfaces

    • Structure-based virtual screening campaigns

    • Fragment-based drug discovery approaches

These structural insights would guide the development of small molecule inhibitors or antibodies targeting TC_0306 if it proves to be essential for chlamydial infection or pathogenesis.

What are the most promising approaches for elucidating TC_0306's function?

Several complementary approaches can help determine TC_0306's function:

  • Genetic manipulation:

    • Generate TC_0306 knockout or conditional mutants using transposon mutagenesis systems

    • Create point mutations at conserved residues to identify functional domains

    • Use CRISPR interference systems adapted for Chlamydia to regulate expression

  • Protein interaction studies:

    • Perform pull-down assays using recombinant TC_0306 to identify binding partners

    • Employ bacterial two-hybrid systems to screen for protein-protein interactions

    • Use proximity labeling techniques to identify neighboring proteins in the native context

  • Transcriptomic and proteomic profiling:

    • Compare gene expression patterns between wild-type and TC_0306-mutant strains

    • Apply iTRAQ or other quantitative proteomics methods to identify affected pathways

    • Analyze temporal expression patterns during the chlamydial developmental cycle

  • Localization studies:

    • Develop specific antibodies against TC_0306 for immunofluorescence microscopy

    • Use fluorescent protein fusions to track localization during infection

    • Employ immunoelectron microscopy for high-resolution localization

How can researchers evaluate the potential role of TC_0306 in chlamydial pathogenesis?

To assess TC_0306's contribution to chlamydial pathogenesis:

  • Animal model studies:

    • Compare infection outcomes between wild-type and TC_0306-mutant strains in mouse models

    • Evaluate pathological changes in the genital tract tissue

    • Measure immune responses, including T-cell activation and cytokine production

  • Host cell interaction assays:

    • Analyze alterations in signaling pathways (e.g., PI3K/Akt, NF-κB) in cells infected with TC_0306-mutant versus wild-type strains

    • Assess changes in inflammatory responses and fibrosis markers

    • Evaluate effects on host cell survival, proliferation, and cytoskeletal organization

  • Comparative studies with homologous proteins:

    • Investigate the function of TC_0306 homologs in other Chlamydia species (e.g., CT_036 in C. trachomatis)

    • Perform complementation studies to determine functional conservation

    • Identify species-specific adaptations that might reflect host tropism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.