Recombinant Chlamydia muridarum UPF0056 membrane protein TC_0241 (TC_0241)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant TC_0241 is a full-length membrane protein (1–204 amino acids) fused to an N-terminal His tag for purification. Key specifications include:

PropertyDetails
UniProt IDQ9PL67
Expression SystemEscherichia coli
Protein Length204 amino acids
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

The amino acid sequence is:
MLHSLFRLTLLFYALFNSLGSLPVFVALLKKFSFRKQQRIILRECIFALLTLILFITFGQGFFRLLEVSLPAFQLTGGILLGSLAINMMKALPSQEETFDQYEDEPIFYPLAFPVITGPATITSTLGHMEEGIFPKELVLGAIMLAWAFSLITLFFSSSINRLFGQMGLLALERLFGISLALMAGNLMLKAISTAFNIGYYVMA .

Antigenic and Vaccine Potential

While TC_0241 itself has not been tested as a vaccine candidate, related C. muridarum membrane proteins (e.g., PmpG, MOMP) induce protective immunity in murine models . TC_0241’s structural similarity to immunogenic Chlamydia proteins supports its potential as a vaccine antigen, though empirical validation is required.

Host-Pathogen Interactions

TC_0241 may contribute to immune modulation:

  • Murine models of C. muridarum infection show upregulation of host defense genes (e.g., IDO1-2, CXCL chemokines) during lung infection, which could intersect with TC_0241-mediated immune evasion .

  • Membrane proteins like TC_0241 are critical for bacterial attachment and inclusion formation, as seen in C. muridarum mutants with attenuated pathogenicity .

Knowledge Gaps and Future Directions

  • Functional Validation: The precise role of TC_0241 in C. muridarum virulence or immune evasion remains uncharacterized.

  • Structural Studies: No crystal or cryo-EM structures are available for TC_0241 or its homologs.

  • Therapeutic Exploration: Its potential as a drug target or vaccine component warrants investigation, building on successes with other Chlamydia antigens .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific requirements for the format, kindly indicate them in your order notes and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for precise delivery time estimates.
For your information, all our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended for this product. We suggest storing working aliquots at 4°C for a maximum of one week.
Reconstitution
To ensure optimal reconstitution, we recommend briefly centrifuging the vial before opening to settle the contents. Please reconstitute the protein in deionized sterile water to a final concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for long-term storage at -20°C or -80°C. As a standard practice, we include 50% glycerol in the final concentration. Customers can use this as a reference point for their own preparations.
Shelf Life
The shelf life of this product can be influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months when stored at -20°C or -80°C. For the lyophilized form, the shelf life is 12 months when stored at -20°C or -80°C.
Storage Condition
Upon receipt, store the product at -20°C or -80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
TC_0241; UPF0056 membrane protein TC_0241
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Chlamydia muridarum (strain MoPn / Nigg)
Target Names
TC_0241
Target Protein Sequence
MLHSLFRLTLLFYALFNSLGSLPVFVALLKKFSFRKQQRIILRECIFALLTLILFITFGQ GFFRLLEVSLPAFQLTGGILLGSLAINMMKALPSQEETFDQYEDEPIFYPLAFPVITGPA TITSTLGHMEEGIFPKELVLGAIMLAWAFSLITLFFSSSINRLFGQMGLLALERLFGISL ALMAGNLMLKAISTAFNIGYYVMA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of TC_0241 and how does it compare to other membrane proteins in Chlamydia species?

TC_0241 is a full-length membrane protein (204 amino acids) belonging to the UPF0056 family in Chlamydia muridarum. The protein's amino acid sequence is: MLHSLFRLTLLFYALFNSLGSLPVFVALLKKFSFRKQQRIILRECIFALLTLILFITFGQGFFRLLEVSLPAFQLTGGILLGSLAINMMKALPSQEETFDQYEDEPIFYPLAFPVITGPATITSTLGHMEEGIFPKELVLGAIMLAWAFSLITLFFSSSINRLFGQMGLLALERLFGISLALMAGNLMLKAISTAFNIGYYVMA .

Analysis of this sequence reveals characteristic features of a membrane protein, including hydrophobic regions that likely span the bacterial membrane. Comparative analysis with other chlamydial membrane proteins shows conserved domains that may be critical for membrane integration and function. Unlike virulence factors such as TC0668, which has been extensively studied for its role in pathogenesis, TC_0241's functional characterization remains less developed in the current literature.

How is TC_0241 expressed and localized within the Chlamydia muridarum organism?

TC_0241 is expressed as a membrane protein in C. muridarum and is likely localized to the bacterial membrane based on its sequence characteristics. For experimental verification of protein localization, researchers commonly employ immunofluorescence techniques similar to those used for other chlamydial proteins.

A methodological approach would involve:

  • Generating specific antibodies against TC_0241

  • Fixing infected cells with 4% paraformaldehyde (30 min at 37°C)

  • Permeabilizing with 0.1% Triton-100 in PBS (15 min)

  • Blocking non-specific binding sites

  • Incubating with anti-TC_0241 primary antibody and fluorescently-labeled secondary antibody

  • Counterstaining with DAPI to visualize nuclei

  • Visualization using fluorescence microscopy

This approach, similar to that used for TC0668 localization studies, would enable researchers to determine the precise subcellular localization of TC_0241 during different stages of the chlamydial developmental cycle.

What are the optimal conditions for expressing recombinant TC_0241 protein in E. coli systems?

The recombinant expression of TC_0241 in E. coli systems requires careful optimization due to potential challenges associated with membrane protein expression. Based on established protocols for similar chlamydial proteins, researchers should consider:

  • Selection of expression vector and host strain:

    • pET vector systems with N-terminal His-tags have demonstrated success for TC_0241

    • BL21(DE3) or Rosetta strains typically provide good expression levels for chlamydial proteins

  • Induction conditions:

    • IPTG concentration: 0.1-0.5 mM

    • Induction temperature: Lower temperatures (16-25°C) often improve membrane protein folding

    • Induction duration: 4-16 hours depending on temperature

  • Culture media optimization:

    • Rich media (e.g., TB or 2YT) supplemented with glucose may enhance expression

    • Consider auto-induction media for higher biomass and protein yields

  • Cell lysis and solubilization:

    • Mechanical disruption (sonication or high-pressure homogenization)

    • Membrane fraction isolation via ultracentrifugation

    • Detergent solubilization (e.g., n-dodecyl-β-D-maltoside or CHAPS)

This methodological approach aligns with successful expression strategies for other chlamydial membrane proteins and should yield functional TC_0241 for downstream applications.

What purification strategies yield the highest purity and stability for recombinant TC_0241?

For optimal purification of His-tagged TC_0241, a multi-step purification strategy is recommended:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Ni-NTA or Co-based resins with gradual imidazole elution (20-250 mM)

    • Include detergents throughout purification to maintain protein solubility

    • Buffer composition: Tris/PBS-based buffer, pH 8.0

  • Size Exclusion Chromatography (SEC):

    • Further purification and assessment of oligomeric state

    • Superdex 200 column with detergent-containing buffer

  • Storage and stability optimization:

    • Addition of 6% trehalose as a stabilizing agent

    • Aliquoting and storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) for long-term storage

This purification approach typically yields protein with >90% purity as determined by SDS-PAGE , suitable for structural and functional studies.

What experimental approaches are most effective for determining the function of TC_0241 in Chlamydia pathogenesis?

Several complementary approaches can be employed to elucidate TC_0241's function in chlamydial pathogenesis:

  • Genetic manipulation strategies:

    • Generation of TC_0241 mutant strains using techniques similar to those employed for TC0668 mutation (e.g., introducing premature stop codons)

    • Complementation studies to confirm phenotype-genotype relationships

  • Comparative proteomics analysis:

    • iTRAQ-based quantitative proteomics to identify differentially expressed host proteins in wild-type versus TC_0241 mutant infections

    • Analysis at various time points post-infection (e.g., 6, 12, 18, and 24 hours) to capture temporal dynamics

  • Cell biology approaches:

    • Infection of relevant cell lines (e.g., HeLa cells) with wild-type and mutant strains

    • Assessment of inclusion formation, bacterial growth, and host cell responses

    • Immunofluorescence microscopy to visualize infection progression

  • Animal model studies:

    • Comparison of upper genital tract pathology in mice infected with wild-type versus TC_0241 mutant strains

    • Histopathological examinations to assess tissue damage and inflammatory responses

These methodologies, particularly the iTRAQ proteomics approach, have proven valuable in characterizing other chlamydial virulence factors such as TC0668 and would likely provide significant insights into TC_0241 function.

How does TC_0241 interact with host cell proteins during infection?

Understanding TC_0241's interactions with host proteins requires a systematic approach:

  • Protein-protein interaction (PPI) studies:

    • Immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling techniques (BioID or APEX2)

  • Functional pathway analysis:

    • GO (Gene Ontology) and KEGG (Kyoto Encyclopedia of Genes and Genomes) pathway analyses of interacting proteins

    • Focus on inflammatory responses, fibrosis, metabolic processes, and signaling pathways potentially affected by TC_0241

  • Validation of key interactions:

    • Co-immunoprecipitation of TC_0241 with candidate host proteins

    • Quantitative real-time PCR (qRT-PCR) validation of expression changes

    • Western blotting and immunofluorescence detection to confirm pathway activation

Based on studies of other chlamydial proteins like TC0668, potential pathways of interest might include PI3K/Akt, NF-κB, and other signaling pathways involved in inflammation and fibrosis .

How conserved is TC_0241 across different Chlamydia species and what does this suggest about its functional importance?

To assess TC_0241 conservation and evolutionary significance:

  • Comparative genomic analysis:

    • Sequence alignment of TC_0241 homologs across Chlamydia species

    • Identification of conserved domains and motifs

    • Calculation of selection pressures (dN/dS ratios) to identify positively selected residues

  • Structural prediction and comparison:

    • Secondary structure prediction using bioinformatic tools

    • 3D structure modeling via homology modeling or ab initio methods

    • Identification of conserved structural features across homologs

  • Phylogenetic analysis:

    • Construction of phylogenetic trees based on TC_0241 sequences

    • Comparison with species phylogeny to identify potential horizontal gene transfer events

    • Analysis of evolutionary rates in different chlamydial lineages

High conservation across species would suggest functional importance in the chlamydial life cycle, while divergence might indicate species-specific adaptations. Comparative analysis with other membrane proteins like TC0668, which has established significance in upper genital tract pathogenesis , would provide context for TC_0241's evolutionary importance.

How can proteomics approaches be optimized to study the impact of TC_0241 on host-pathogen interactions?

Advanced proteomics strategies for TC_0241 research:

  • Optimized iTRAQ-based quantitative proteomics workflow:

    StepMethodologyCritical Parameters
    Sample preparationInfection of HeLa cells with TC_0241 wild-type and mutant strainsMOI=1, time points: 6, 12, 18, 24h p.i.
    Protein extractionDetergent-based lysis, on-filter digestionComplete solubilization, protein quantification
    Peptide labelingiTRAQ 8-plex labelingpH control, complete labeling verification
    FractionationHigh-pH reversed-phase fractionation12-15 fractions for optimal coverage
    LC-MS/MS analysisNano-LC coupled to high-resolution MSLonger gradients (>2h) for deeper coverage
    Data analysisDatabase searching, quantificationFalse discovery rate <1%, ≥2 unique peptides per protein
  • Integration with other -omics approaches:

    • Transcriptomics (RNA-seq) to correlate protein with mRNA changes

    • Metabolomics to identify altered metabolic pathways

    • Phosphoproteomics to characterize signaling pathway activation

  • Targeted validation studies:

    • Selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) for precise quantification of key proteins

    • Western blotting and qRT-PCR validation of significantly altered proteins

This comprehensive proteomic approach, similar to that used for TC0668 , would enable identification of differentially expressed proteins between wild-type and mutant infections, providing insights into TC_0241's role in pathogenesis.

What methods can be used to develop inhibitors or antagonists targeting TC_0241 for potential therapeutic applications?

Development of TC_0241-targeting therapeutics would follow this research pipeline:

  • Structure-based drug design approach:

    • Determination of TC_0241 structure via X-ray crystallography or cryo-EM

    • Identification of druggable pockets through computational analysis

    • Virtual screening of compound libraries against identified binding sites

  • Fragment-based drug discovery:

    • Screening of fragment libraries using NMR, SPR, or thermal shift assays

    • Fragment growing and linking to develop high-affinity ligands

    • Structure-activity relationship (SAR) studies

  • Functional assays for inhibitor validation:

    • In vitro binding assays (isothermal titration calorimetry, surface plasmon resonance)

    • Cell-based assays measuring inhibition of TC_0241 function

    • Infection models to assess impact on bacterial growth and pathogenesis

  • Advanced delivery strategies:

    • Development of formulations capable of targeting intracellular bacteria

    • Assessment of cell penetration and intracellular accumulation

    • Optimization of pharmacokinetic properties

This therapeutic development pipeline would leverage structural insights into TC_0241 while addressing the challenges of targeting an intracellular bacterial pathogen.

What are the main technical challenges in expressing and purifying TC_0241, and how can they be addressed?

Researchers working with TC_0241 commonly encounter several technical challenges:

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize by using specialized strains (C41/C43, Lemo21), lower induction temperatures (16-20°C), and extended induction times (16-24 hours)

  • Protein aggregation:

    • Challenge: TC_0241 may form inclusion bodies or aggregate during purification

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) at varying concentrations; consider fusion partners (MBP, SUMO) to enhance solubility

  • Protein instability:

    • Challenge: Purified protein may degrade or lose activity during storage

    • Solution: Include stabilizing agents (trehalose 6%, glycerol 5-50%) in storage buffer ; aliquot and avoid freeze-thaw cycles

  • Functional assay development:

    • Challenge: Establishing reliable assays to measure TC_0241 activity

    • Solution: Develop multiple complementary assays (binding, liposome reconstitution, cell-based) to assess different aspects of function

A systematic approach to these challenges, documented with detailed troubleshooting notes, will significantly enhance research progress with this challenging membrane protein.

How can researchers effectively validate the specificity and functionality of anti-TC_0241 antibodies for research applications?

Rigorous antibody validation is critical for reliable TC_0241 research:

  • Comprehensive validation protocol:

    Validation MethodExperimental ApproachExpected Outcome
    Western blotCompare wild-type vs. TC_0241 knockout/mutant samplesSingle band at expected MW in wild-type only
    ImmunoprecipitationPull-down followed by mass spectrometryTC_0241 as top hit with high peptide coverage
    ImmunofluorescenceCompare staining patterns in wild-type vs. mutant strainsSpecific membrane-associated signal in wild-type
    Peptide competitionPre-incubation with immunizing peptideSignal elimination or significant reduction
    Knockout/knockdown controlsCRISPR or siRNA approaches where applicableAbsence of signal in depleted samples
  • Cross-reactivity assessment:

    • Testing against related UPF0056 family proteins

    • Evaluation in multiple chlamydial species

    • Assessment of non-specific binding to host proteins

  • Functional blocking studies:

    • Determination if antibodies neutralize TC_0241 function

    • Assessment of impact on bacterial growth or host interactions

This systematic validation approach ensures antibody specificity and reliability, critical for accurate interpretation of TC_0241 research findings.

What emerging technologies could advance our understanding of TC_0241's role in Chlamydia infection and pathogenesis?

Several cutting-edge approaches hold promise for TC_0241 research:

  • CRISPR interference in Chlamydia:

    • Adaptation of CRISPRi systems for conditional knockdown of TC_0241

    • Temporal control of expression to study stage-specific functions

    • Combination with transcriptomics/proteomics for comprehensive analysis

  • Cryo-electron tomography:

    • Visualization of TC_0241 in its native membrane environment

    • Determination of spatial organization during different infection stages

    • Integration with subtomogram averaging for higher resolution insights

  • Advanced protein-protein interaction mapping:

    • Proximity labeling approaches (BioID, APEX2) adapted for chlamydial proteins

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational analyses

  • Single-cell approaches:

    • Single-cell RNA-seq of infected host cells to capture heterogeneity in responses

    • Spatial transcriptomics to correlate TC_0241 expression with local tissue responses

    • Integration of multi-omics data at single-cell resolution

These emerging technologies would complement established methods like iTRAQ proteomics , potentially revealing previously uncharacterized aspects of TC_0241 function in chlamydial pathogenesis.

How might TC_0241 research inform broader understanding of bacterial membrane proteins and host-pathogen interactions?

TC_0241 research has potential implications beyond Chlamydia biology:

  • Model system for membrane protein research:

    • Insights into expression, purification, and structural determination of challenging bacterial membrane proteins

    • Development of methodologies applicable to other difficult-to-study membrane proteins

  • Comparative pathogenesis mechanisms:

    • Identification of conserved strategies across intracellular pathogens

    • Understanding of evolutionary convergence in host interaction mechanisms

  • Novel therapeutic approaches:

    • Target identification for broad-spectrum anti-bacterial therapeutics

    • Insights into disrupting key host-pathogen interfaces

    • Development of adjunct therapies to enhance antibiotic effectiveness

  • Fundamental membrane biology:

    • Understanding of protein-lipid interactions in bacterial membranes

    • Insights into trafficking and localization mechanisms of bacterial proteins

Research on TC_0241, particularly when integrated with studies of other membrane proteins like TC0668 , contributes to a more comprehensive understanding of bacterial pathogenesis mechanisms and host-pathogen coevolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.