Recombinant Chlamydia pneumoniae 3-deoxy-D-manno-octulosonic-acid transferase (waaA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydia pneumoniae 3-deoxy-D-manno-octulosonic-acid transferase (WaaA)

Chlamydia pneumoniae is a common respiratory pathogen associated with community-acquired respiratory infections and linked to conditions such as atherosclerosis . The accurate diagnosis and understanding of C. pneumoniae infections are crucial for effective clinical and epidemiological management . Recombinant Chlamydia pneumoniae 3-deoxy-D-manno-octulosonic-acid transferase (WaaA) is an enzyme involved in the biosynthesis of lipopolysaccharide (LPS), a major component of the outer membrane of Gram-negative bacteria, including C. pneumoniae .

Molecular Cloning and Sequence Analysis of kdtA Gene

The kdtA gene, which encodes the 3-deoxy-alpha-D-manno-octulosonic acid (Kdo) transferase (WaaA), has been cloned and sequenced in C. pneumoniae strain TW-183 . The analysis revealed a single open reading frame of 1314 base pairs . The deduced amino acid sequence showed significant similarity to KdtA of other Chlamydia species, such as Chlamydia trachomatis and Chlamydia psittaci . Specifically, it shares 69% similarity and 43% identity with KdtA from these species .

Functional Characterization as a Glycosyltransferase

The kdtA gene product, WaaA, has been characterized as a multifunctional glycosyltransferase . Glycosyltransferases are enzymes that catalyze the transfer of monosaccharide moieties from activated nucleotide sugars to specific acceptor molecules, forming glycosidic bonds . In C. pneumoniae, WaaA is involved in the synthesis of the genus-specific epitope of Chlamydia, which is composed of a trisaccharide: alphaKdo(2-8)alphaKdo(2-4)alphaKdo .

Role in Lipopolysaccharide (LPS) Biosynthesis

WaaA plays a crucial role in the biosynthesis of the lipopolysaccharide (LPS) core . LPS is a major component of the outer membrane of most Gram-negative bacteria and is essential for the structural integrity and barrier function of the outer membrane . It consists of three parts:

  1. Lipid A: A hydrophobic anchor that is embedded in the outer membrane.

  2. Core Oligosaccharide: A short chain of sugars directly attached to Lipid A.

  3. O-antigen: A highly variable polysaccharide chain that extends outward from the core oligosaccharide.

WaaA is specifically involved in the transfer of 3-deoxy-D-manno-octulosonic acid (Kdo) to the LPS core . Kdo is a unique sugar found in the LPS of many Gram-negative bacteria and is often located at the innermost part of the core oligosaccharide, directly linked to Lipid A . The addition of Kdo by WaaA is a critical step in the LPS biosynthesis pathway, and mutations in WaaA or other enzymes involved in LPS biosynthesis can lead to defects in LPS structure and function .

Implications for Serodiagnosis

Recombinant antigens, including WaaA, have been investigated for their potential in serodiagnosis of C. pneumoniae infections . Serodiagnosis involves the detection of antibodies against specific antigens in patient serum, which can indicate current or past infection . While some surface antigens have performed poorly, other virulence-associated antigens like TARP have shown promise for IgM detection . The hypothetical protein YwbM has also been identified as a powerful antigen for IgG detection . These findings suggest that specific C. pneumoniae antigens, including WaaA, could be used to develop more reliable and standardized serological assays for epidemiological studies .

Chlamydia pneumoniae-Specific Gene Cluster

C. pneumoniae possesses a unique gene cluster of 13 genes (mbp1-13) that encodes highly homologous chlamydial proteins with the ability to bind to membranes . This gene cluster is located on the chromosome between the pmp15 and pmp14 genes . These proteins contain domains of unknown function (DUF575 and DUF562), crucial for the association of cluster proteins to the endo-membrane system . Although some of these cluster proteins can bind to human cells, they do not appear to play a significant role in the adhesion process of the elementary body (EB) to the host cell surface .

Recombinant 43- and 53-Kilodalton Proteins

Two proteins of C. pneumoniae with molecular masses of 43 and 53 kDa have been reported to be frequently recognized during human infection . These proteins were evaluated as potential candidates for an alternative serological test to the microimmunofluorescence (micro-IF) assay . The 53-kDa protein encoded by CPn0980 showed potential for serodiagnosis of C. pneumoniae infection, as it was recognized by a high percentage of acute-phase and chronic sera .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
waaA; gseA; kdtA; CPn_0154; CP_0617; CpB0155; 3-deoxy-D-manno-octulosonic acid transferase; Kdo transferase; Kdo(2-lipid IV(A 3-deoxy-D-manno-octulosonic acid transferase; Kdo-lipid IV(A 3-deoxy-D-manno-octulosonic acid transferase; Lipid IV(A 3-deoxy-D-manno-octulosonic acid transferase; Trifunctional Kdo transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-437
Protein Length
full length protein
Species
Chlamydia pneumoniae (Chlamydophila pneumoniae)
Target Names
waaA
Target Protein Sequence
MMLRGVHRIFKCFYDVVLVCAFVIALPKLLYKMLVYGKYKKSLAVRFGLKKPHVPGEGPL VWFHGASVGEVRLLLPVLEKFCEEFPGWRCLVTSCTELGVQVASQVFIPMGATVSILPLD FSIIIKSVVAKLRPSLVVFSEGDCWLNFIEEAKRIGATTLVINGRISIDSSKRFKFLKRL GKNYFSPVDGFLLQDEVQKQRFLSLGIPEHKLQVTGNIKTYVAAQTALHLERETWRDRLR LPTDSKLVILGSMHRSDAGKWLPVVQKLIKEGVSVLWVPRHVEKTKDVEESLHRLHIPYG LWSRGANFSYVPVVVVDEIGLLKQLYVAGDLAFVGGTFDPKIGGHNLLEPLQCEVPLIFG PHITSQSELAQRLLLSGAGLCLDEIEPIIDTVSFLLNNQEVREAYVQKGKVFVKAETASF DRTWRALKSYIPLYKNS
Uniprot No.

Target Background

Function

Recombinant Chlamydia pneumoniae 3-deoxy-D-manno-octulosonic-acid transferase (WaaA) is involved in lipopolysaccharide (LPS) biosynthesis. It catalyzes the transfer of three 3-deoxy-D-manno-octulosonate (Kdo) residues from CMP-Kdo to lipid IV(A), the tetraacyldisaccharide-1,4'-bisphosphate precursor of lipid A. This generates the genus-specific LPS epitope of Chlamydia, consisting of the trisaccharide α-Kdo-(2→8)-α-Kdo-(2→4)-α-Kdo.

Database Links

KEGG: cpa:CP_0617

STRING: 182082.CpB0155

Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 30 subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is 3-deoxy-D-manno-octulosonic-acid transferase (waaA) in Chlamydia pneumoniae?

The waaA gene in C. pneumoniae encodes a lipopolysaccharide (LPS)-specific 3-deoxy-D-manno-octulosonic acid (Kdo) transferase. This enzyme is essential for bacterial viability as it catalyzes the transfer of Kdo residues to lipid A, forming a critical component of the bacterial outer membrane structure. Unlike many other bacterial enzymes, chlamydial Kdo transferases have distinct product specificities that influence membrane architecture and pathogen-host interactions .

Structurally, the C. pneumoniae waaA enzyme belongs to the glycosyltransferase family, with conserved domains that are critical for substrate recognition and catalytic activity. Understanding its structure-function relationship is essential for targeting this enzyme in therapeutic interventions.

How does C. pneumoniae waaA differ from waaA in related chlamydial species?

Comparative analysis reveals significant variations in product specificity among chlamydial waaA enzymes:

Chlamydial SpecieswaaA Product SpecificityPrimary Structure FormedFunctional Implications
C. pneumoniaeMulti-Kdo transferaseBranched Kdo oligosaccharideDistinct membrane architecture
C. trachomatisLimited Kdo transferLinear Kdo structureDifferent host cell interactions
C. psittaciTransfers four Kdo residuesBranched tetrasaccharide with α-Kdo-(2→8)-[α-Kdo-(2→4)]-α-Kdo-(2→4)-α-Kdo structureEnhanced membrane stability

Research has demonstrated that when expressed in E. coli K-12 waaA-deficient strains, these chlamydial Kdo transferases retain their native product specificities, indicating intrinsic enzymatic characteristics independent of cellular background . This conservation of function makes them valuable models for studying evolutionary divergence in glycosyltransferases.

What role does waaA play in C. pneumoniae pathogenesis?

The waaA enzyme is critical for synthesizing functional LPS, which serves as both a structural component and virulence factor. Methodologically, researchers have approached this question through:

  • Complementation studies in heterologous systems

  • Structural analysis of LPS products

  • Immunological assessments of host responses

Research indicates that variations in Kdo patterns influence recognition by host immune receptors, potentially affecting inflammatory responses during infection. The branched Kdo structures created by C. pneumoniae waaA may help the pathogen evade immune detection or modulate host responses in ways that support persistent infection .

What expression systems are optimal for producing functional recombinant C. pneumoniae waaA?

When selecting an expression system for recombinant C. pneumoniae waaA, consider these methodological approaches:

  • E. coli-based systems: Most commonly used due to ease of genetic manipulation. For optimal expression:

    • Use pET vectors with T7 promoter systems for controlled expression

    • Cultivate at lower temperatures (16-25°C) to enhance protein folding

    • Consider fusion tags (His, MBP, GST) to improve solubility and facilitate purification

  • Chlamydial expression systems: Using the recently developed genetic transformation system with plasmid shuttle vectors like pRSGFPCAT-Cpn allows expression in the native cellular environment .

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, easy manipulationPotential misfoldingLower induction temperature (16°C), chaperone co-expression
C. pneumoniae transformationNative environment, proper foldingLower yield, technical complexityUse chloramphenicol selection, optimize codon usage
Cell-free systemsRapid production, avoids toxicityLower yield, higher costSupplement with membrane mimetics

Successful expression has been achieved using complementation approaches in waaA-deficient E. coli strains, as demonstrated in comparative studies of chlamydial Kdo transferases .

How can genetic manipulation techniques be applied to study waaA function in C. pneumoniae?

Recent breakthroughs in C. pneumoniae transformation have revolutionized genetic studies of this organism:

  • Plasmid shuttle vector system: The pRSGFPCAT-Cpn construct can be used to express modified versions of waaA, with RSGFP fusion facilitating visualization of expression .

  • Methodological approach:

    • Construct plasmids containing the waaA gene with desired modifications

    • Transform C. pneumoniae using established protocols

    • Select transformants using chloramphenicol resistance

    • Verify stable maintenance of the plasmid even without selection pressure

    • Analyze phenotypic effects through microscopy and biochemical assays

This approach has been validated with multiple C. pneumoniae isolates, including human cardiovascular isolate CV-6 and community-acquired pneumonia-associated IOL-207, demonstrating the broad applicability of this technique . Importantly, researchers should monitor growth characteristics and chlamydial morphology to ensure transformation does not alter basic biological properties.

What analytical methods are most effective for characterizing recombinant waaA enzymatic activity?

A multi-technique approach is recommended:

  • High-performance anion exchange chromatography (HPAEC):

    • Enables separation and quantification of Kdo-containing oligosaccharides

    • Can distinguish products with different branching patterns

    • Typically performed with pulsed amperometric detection

  • Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF MS):

    • Provides precise molecular mass determination of LPS products

    • Allows structural characterization of Kdo patterns

    • Can identify unexpected modifications

  • Immunological assays using specific monoclonal antibodies:

    • Confirm structural features through epitope recognition

    • Enable detection of specific Kdo arrangements

    • Useful for comparing products across different expression systems

These methods have successfully demonstrated that chlamydial Kdo transferases maintain their specific product profiles when expressed heterologously, confirming the intrinsic enzymatic characteristics of waaA proteins from different Chlamydia species .

How does C. pneumoniae waaA contribute to immune evasion strategies?

Investigation of waaA's role in immune evasion requires sophisticated immunological approaches:

  • Humoral immune response characterization:

    • Research has shown that while surface antigens perform poorly in diagnostic specificity, virulence-associated proteins like TARP achieve 80.0% sensitivity and 90.2% specificity for IgM detection .

    • Studies should examine whether waaA-mediated LPS modifications affect antibody recognition.

  • Methodological approach for immune response assessment:

    • Recombinantly express waaA and LPS components

    • Line antigens on nitrocellulose strips

    • Measure specific IgM and IgG reactivity using characterized serum samples

    • Compare to PCR and micro-immunofluorescence testing (MIF) results

The pattern of Kdo addition catalyzed by waaA influences LPS structure, potentially affecting host recognition and subsequent immune responses. This structure-function relationship may be a key factor in C. pneumoniae's ability to establish persistent infections.

What structural characteristics determine the substrate specificity of C. pneumoniae waaA?

Understanding substrate specificity requires integration of structural biology approaches:

  • Structural analysis methods:

    • X-ray crystallography of purified recombinant waaA

    • Molecular dynamics simulations of enzyme-substrate interactions

    • Site-directed mutagenesis of putative catalytic residues

  • Comparative analysis framework:

    • Align C. pneumoniae waaA with enzymes from C. psittaci and C. trachomatis

    • Identify conserved vs. variable regions

    • Correlate sequence variations with differences in Kdo transfer patterns

  • Substrate binding studies:

    • Isothermal titration calorimetry to measure binding affinities

    • Nuclear magnetic resonance to map interaction surfaces

    • Development of fluorescent or radioactive substrate analogs

The distinctive branched Kdo pattern produced by C. pneumoniae waaA suggests unique structural features that dictate the positioning of Kdo residues during consecutive transfer reactions. Identifying these determinants could provide targets for species-specific inhibitors .

How can contradictory experimental results in waaA studies be reconciled?

When facing contradictory results in waaA research, implement this structured approach:

  • Experimental system validation:

    • Verify the genetic background of expression hosts

    • Confirm the sequence of recombinant constructs

    • Validate protein expression through multiple detection methods

  • Methodological considerations:

    • Assess enzyme preparation methods (detergent solubilization vs. membrane fractions)

    • Compare in vitro vs. in vivo activity measurement approaches

    • Standardize substrate preparation and reaction conditions

  • Data analysis framework:

    • Apply consistent statistical approaches to evaluate significance

    • Consider the influence of experimental variables through multivariate analysis

    • Develop clear data table formats that capture all relevant parameters

ParameterPotential VariationEffect on ResultsStandardization Approach
Expression systemMembrane compositionAltered enzyme foldingUse matched control samples
Assay temperatureEnzyme stabilityActivity differencesPerform thermal stability tests
Substrate purityCompeting reactionsReduced specificityHPLC purification of substrates
Detergent typeEnzyme conformationChanged activity profileTest multiple detergent conditions

Systematic evaluation of these variables can help reconcile apparently contradictory results by identifying conditional factors that influence enzyme behavior.

How can recombinant C. pneumoniae waaA be exploited for development of novel diagnostics?

The potential of waaA-based diagnostics builds on recent advances in C. pneumoniae antigen characterization:

  • Development methodology:

    • Express recombinant waaA alongside other immunogenic C. pneumoniae proteins

    • Create line immunoassays on nitrocellulose strips

    • Validate with PCR-confirmed clinical samples

    • Compare performance to established micro-immunofluorescence testing (MIF)

  • Integration with other biomarkers:

    • Research has demonstrated that while surface antigens perform poorly, virulence-associated proteins like TARP achieve 80.0% sensitivity and 90.2% specificity for IgM detection

    • Hypothetical proteins like YwbM have shown up to 94.4% sensitivity and 95.1% specificity for IgG detection

    • Combining waaA-derived antigens with these markers could enhance diagnostic accuracy

  • Application to epidemiological studies:

    • The improved diagnostic specificity would enable more accurate seroprevalence studies

    • Longitudinal monitoring of antibody responses could track infection dynamics

    • Population-level screening would benefit from standardized recombinant antigens

The ongoing challenge of C. pneumoniae diagnosis underscores the need for innovative approaches that leverage specific bacterial components like waaA-derived epitopes.

What bioinformatic approaches can enhance the study of C. pneumoniae waaA sequence-structure-function relationships?

Contemporary bioinformatic analysis of waaA involves:

  • Comparative genomic analysis:

    • Alignment of waaA sequences across Chlamydia species

    • Identification of conserved catalytic domains

    • Detection of selection pressure on specific residues

  • Structural prediction methods:

    • Homology modeling based on related glycosyltransferases

    • Molecular dynamics simulations of substrate interactions

    • Identification of conformational changes during catalysis

  • Functional network analysis:

    • Integration with other LPS biosynthesis genes

    • Prediction of protein-protein interactions

    • Correlation with virulence phenotypes across isolates

These computational approaches can guide experimental design by identifying key residues for mutagenesis and suggesting mechanism-based inhibition strategies that could be exploited for antimicrobial development.

How should researchers design experiments to compare waaA function across different Chlamydia species?

A rigorous comparative analysis requires:

  • Standardized expression system:

    • Use identical vector backbones and expression conditions

    • Apply the knockout complementation approach in E. coli K-12 waaA-deficient strains

    • Ensure equivalent protein expression levels through quantitative Western blotting

  • Comprehensive functional characterization:

    • Analyze LPS composition through HPAEC

    • Determine molecular structures via MALDI-TOF MS

    • Confirm structural features using specific monoclonal antibodies

  • Data presentation for comparative analysis:

Chlamydia SpeciesKdo Transfer PatternLPS StructureGrowth ComplementationSerological Properties
C. pneumoniaeMulti-Kdo transferaseBranchedCompleteSpecies-specific epitopes
C. trachomatisLimited transferLinearCompleteDistinct antibody recognition
C. psittaciFour Kdo residuesBranched tetrasaccharideCompleteUnique serological profile

This approach has successfully demonstrated that chlamydial Kdo transferases retain their product specificities when expressed in E. coli, highlighting the intrinsic nature of their enzymatic characteristics regardless of cellular context .

What are the critical quality control parameters for recombinant C. pneumoniae waaA preparation?

Ensure research reproducibility through rigorous quality control:

  • Protein purity assessment:

    • SDS-PAGE with Coomassie staining (>95% purity)

    • Western blot with anti-tag antibodies

    • Mass spectrometry verification of intact protein mass

  • Functional validation:

    • Specific activity determination using standardized substrates

    • Kinetic parameter measurement (Km, Vmax)

    • Product verification through structural analysis

  • Storage stability evaluation:

    • Activity retention after freeze-thaw cycles

    • Long-term stability at different temperatures

    • Effect of stabilizing additives on enzyme activity

Documenting these parameters in standardized data tables enhances research reproducibility and facilitates meaningful comparisons between studies, addressing a common challenge in enzymatic characterization work .

What are the most promising future research avenues for C. pneumoniae waaA?

Strategic research priorities should include:

  • Structure-based drug design:

    • Crystal structure determination of C. pneumoniae waaA

    • Virtual screening for species-specific inhibitors

    • Rational design of transition-state analogs

  • Integration with transformation technologies:

    • Application of the pRSGFPCAT-Cpn vector system for in vivo studies

    • Site-directed mutagenesis of waaA in C. pneumoniae

    • Correlation of LPS modifications with infection outcomes

  • Immunological significance:

    • Impact of waaA-dependent LPS structures on host immunity

    • Potential as vaccine component or adjuvant

    • Role in persistent infection establishment

The recently developed genetic transformation system for C. pneumoniae opens unprecedented opportunities to directly manipulate waaA in its native context, potentially revolutionizing our understanding of this essential enzyme's role in pathogenesis .

How can researchers effectively document and share their methodological approaches to waaA studies?

Best practices for methodology documentation include:

  • Comprehensive protocol sharing:

    • Deposit detailed protocols in repositories like protocols.io

    • Include all buffer compositions and processing parameters

    • Document troubleshooting approaches for common challenges

  • Data presentation standards:

    • Use clear, annotated data tables with appropriate titles

    • Include all measurement units and uncertainties

    • Maintain consistent precision in numerical data

  • Resource availability:

    • Share plasmid constructs through repositories like Addgene

    • Make antibodies and specialized reagents accessible

    • Provide detailed information on bacterial strains used

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.