Recombinant Chlamydia pneumoniae Uncharacterized protein CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 (CPn_0129/CPn_0130, CP_0642, CPj0130, CpB0131)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CPn_0129/CPn_0130; CP_0642; CPj0130; CpB0131; Uncharacterized protein CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Chlamydia pneumoniae (Chlamydophila pneumoniae)
Target Names
CPn_0129/CPn_0130
Target Protein Sequence
MVKCSSIIHENKKPAQLLPESKFAAITKLSLAILSLFLGIAACILIALSGLLPNTLLIIA LSLISIIVLSTGISLLIGTQCSKSVQKDEQKPKSIFPKETPSLDPWLLNPLKNKIQSSET LLLDPTSINLKNELFFPSFEEWKKIFLKDPDFLIKSALANWKILEQDEQYILSHIHMDPR IFVTSEPLQKTYQKLQEKHVNNLGIASQVSLTDLQNKTQYENNLIETTTNEITYYFPVVH NPDILRSEWDPISNQLYLIFKKFFIHYHNLFSTALERNQILLIDSLNTGSSNPIARQMEL LAFLCVFEQLDYNEDEYTIEPRDYFNRFVYKNSQTAPQIQSFGLLHGYEEMSYASNNIRN VLTHSIVLCSPILYQLITEFDTTKIHADDFDCLI
Uniprot No.

Target Background

Database Links

KEGG: cpa:CP_0642

STRING: 182082.CpB0131

Protein Families
Chlamydial CPn_0129/CT_036/TC_0306 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 gene in Chlamydia pneumoniae?

The CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 gene is located within the Chlamydia pneumoniae genome, which has been fully sequenced and annotated. Based on genomic analysis, this gene appears in different strains with various designations (CPn_0129/CPn_0130 in one strain, CP_0642 in another, etc.). The gene is positioned at approximately nucleotide position 162772-163956 in some strains, as indicated by complement annotation (CPJ_RS00670) . Genomic context analysis suggests this protein may be part of the membrane-associated proteins that are characteristic of Chlamydia species, potentially falling into the category of predicted inclusion membrane proteins that are crucial for the intracellular lifestyle of these bacteria .

What structural features characterize the CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 protein?

While specific structural data for this uncharacterized protein is limited, bioinformatic analyses suggest it may contain transmembrane domains characteristic of Chlamydia membrane proteins. Hydropathy plot analysis, similar to that used for inclusion membrane protein prediction, would likely reveal the presence of 2 hydrophobic domains within 40 amino acids of each other or one large hydrophobic domain exceeding 40 amino acids .

Programs like TMHMM can predict transmembrane helices, which would be particularly useful for this protein. Based on similar Chlamydia proteins, it may share features with other membrane proteins that contain two or more transmembrane domains and potentially have a bilobed hydrophobic domain structure . This structural arrangement would be consistent with its hypothesized membrane localization and potential role in host-pathogen interactions.

What are the optimal expression systems for producing recombinant CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131?

The optimal expression system depends on research objectives and downstream applications. For high-yield production, several systems have demonstrated success with Chlamydia proteins:

For optimal results, consider using a truncated gene approach similar to that used for other Chlamydia proteins, where "the gE antigen is obtained by culturing genetically engineered Chinese Hamster Ovary cells, which carry a truncated gE gene, in media containing amino acids, with no albumin, antibiotics, or animal-derived proteins" .

What purification strategies are most effective for isolating recombinant CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131?

For effective purification of recombinant CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131, a multi-step chromatographic approach is recommended:

  • Initial purification: If using an affinity tag system (His-tag, GST-tag), affinity chromatography provides an excellent first step purification.

  • Intermediate purification: Ion exchange chromatography based on the protein's predicted isoelectric point.

  • Final purification: Size-exclusion chromatography to achieve high purity and remove aggregates.

Based on successful purification of other Chlamydia recombinant proteins, "isoelectrofocussing and size-exclusion chromatography" have proven effective . For membrane proteins like CPn_0129/CPn_0130, additional considerations include:

  • Use of appropriate detergents during extraction and purification

  • Optimization of buffer conditions to maintain protein stability

  • Consideration of lipid nanodisc technology for maintaining native-like membrane environment

A documented purification workflow that could be adapted states: "The gE protein is purified by several chromatographic steps, formulated with excipients, filled into vials, and lyophilized" . This multi-step approach ensures high purity while maintaining protein functionality.

What methods can determine the subcellular localization of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 during C. pneumoniae infection?

To determine the subcellular localization of this uncharacterized protein, researchers should employ a combination of techniques:

  • Immunofluorescence microscopy: Generating antibodies against the recombinant protein allows visualization of the native protein during different stages of the C. pneumoniae developmental cycle. This approach has successfully located Chlamydia proteins within infected cells, as demonstrated in studies where "double staining using a FITC-labeled anti-C. pneumoniae LPS mAb and Alexa568-labeled AnxA5" was used to visualize bacteria in host cells .

  • Fractionation studies: Separating bacterial and host cellular components followed by Western blotting can identify which cellular compartment contains the protein of interest.

  • Electron microscopy with immunogold labeling: For higher resolution localization, especially if the protein is hypothesized to be in the inclusion membrane.

  • Live-cell imaging with fluorescent protein fusions: If genetic manipulation systems are available, creating fusions with fluorescent proteins can allow real-time tracking of the protein during infection.

Based on studies of similar Chlamydia proteins, this uncharacterized protein might be found in the inclusion membrane if it shares properties with Inc proteins which are characterized by "bilobed hydrophobic domains" that anchor them in the inclusion membrane .

How can protein-protein interactions of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 be identified and characterized?

For identifying protein-protein interactions, several complementary approaches should be utilized:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CPn_0129/CPn_0130 to pull down protein complexes from infected cells, followed by mass spectrometry to identify binding partners.

  • Yeast two-hybrid screening: A systematic approach to identify potential interacting partners from both bacterial and host proteomes.

  • Protein crosslinking: Chemical crosslinking followed by mass spectrometry can capture transient or weak interactions.

  • Proximity labeling approaches: BioID or APEX2 fusions can identify proteins in close proximity within the cellular environment.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding affinities between purified recombinant CPn_0129/CPn_0130 and candidate interacting proteins.

These methodologies have been successfully applied to characterize other Chlamydia proteins. For instance, studies on C. pneumoniae interactions with host cells have shown that the bacterium "misuses central pathways of apoptotic cell clearance to survive inside human cells" , suggesting complex protein-protein interactions during infection processes.

How conserved is CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 across different Chlamydia species and strains?

The conservation of this protein across Chlamydia species can be assessed through several approaches:

  • Comparative genomic analysis: Multiple sequence alignment of homologous proteins across different Chlamydia species and strains can reveal the degree of conservation. Based on studies of other Chlamydia proteins, conservation patterns can vary significantly. Some inclusion membrane proteins show genetic distances ranging "from 0.001 (CT789) to 0.017 (CT116)" , indicating variable conservation rates.

  • Phylogenetic analysis: Constructing phylogenetic trees to visualize evolutionary relationships.

  • Selective pressure analysis: Calculating Ka/Ks ratios to determine if the gene is under purifying selection, positive selection, or neutral evolution.

A comprehensive analysis would include examination of:

  • Core conserved domains versus variable regions

  • Conservation of predicted structural features

  • Strain-specific variations that might correlate with virulence or tissue tropism

Research on related proteins has shown that "despite being highly conserved, some Incs may be evolving at different rates" , suggesting that functional constraints may vary among membrane proteins in Chlamydia species.

What bioinformatic approaches can predict the function of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131?

Multiple bioinformatic approaches can be integrated to predict the function of this uncharacterized protein:

  • Sequence-based function prediction:

    • BLAST searches against characterized proteins

    • Motif and domain identification using InterPro, Pfam, or SMART

    • Signal peptide prediction using SignalP

  • Structure-based prediction:

    • Ab initio or homology-based 3D structure prediction

    • Structure-function relationship analysis

    • Binding site prediction

  • Genomic context analysis:

    • Operon structure and co-expression patterns

    • Presence of regulatory elements

  • Network-based approaches:

    • Guilt-by-association in protein interaction networks

    • Phylogenetic profiling

When applying these methods, researchers should be aware that "the BLAST algorithm also performs a statistical analysis of the similarity between two sequences" and "a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001" .

How might CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 contribute to C. pneumoniae pathogenesis?

The potential role of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 in pathogenesis can be investigated through several experimental approaches:

  • Comparative expression analysis: Measuring expression levels during different stages of infection and in different infection models. Studies on C. pneumoniae have employed "real-time RT-PCRs of the 16S rRNA in comparison to host cell 18S rRNA using the ΔΔct-method for relative quantification" to measure bacterial gene expression during infection .

  • Loss-of-function studies: If genetic manipulation is possible, creating knockout or knockdown strains to assess effects on virulence.

  • Gain-of-function studies: Heterologous expression in related species or complementation of knockouts.

  • Host response analysis: Evaluating how the protein modulates host immune responses. Research has shown that C. pneumoniae infection can affect cytokine production: "Transfer of apoptotic C. pneumoniae infected PMN to macrophages resulted in an increased TGF-β production, whereas direct infection of macrophages with chlamydiae was characterized by an enhanced TNF-α response" .

If CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 is a membrane protein, it might function similarly to known inclusion membrane proteins that interface with host cells and potentially modulate cellular processes to favor bacterial survival and replication.

What is the potential of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 as a diagnostic marker for C. pneumoniae infection?

The utility of this protein as a diagnostic marker can be evaluated through several approaches:

  • Serological studies: Development of ELISA or other immunoassays to detect antibodies against this protein in patient samples. For such applications, it's important to remember that "specified antibodies bind to a particular protein and do not bind in a significant amount to other proteins present in the sample" .

  • PCR-based detection: Design of specific primers for detecting the gene in clinical specimens. The sensitivity and specificity would need to be compared with existing methods, such as those used in studies where "the presence of circulating C. pneumoniae DNA was determined by real-time PCR assay" .

  • Antigen detection assays: Development of assays to detect the protein directly in clinical specimens.

Evaluation of diagnostic potential should consider:

  • Expression levels during different stages of infection

  • Immunogenicity in human hosts

  • Cross-reactivity with proteins from other organisms

  • Correlation with disease severity

Research has shown that C. pneumoniae detection in blood correlates with disease severity in some contexts: "Sixteen of 269 specimens (5.9%) from the study cohort were positive for C. pneumoniae DNA" and "the prevalence of circulating C. pneumoniae DNA was significantly associated with multi-vessel disease" with an odds ratio of 5.1 (P=0.02) after adjustment for conventional risk factors .

How can structural biology techniques be applied to characterize CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131?

Advanced structural biology techniques offer powerful approaches to characterize this uncharacterized protein:

  • X-ray crystallography: Requires high-quality protein crystals, which can be challenging for membrane proteins but provides atomic-level resolution.

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane proteins, allowing visualization of the protein in a more native-like environment.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: Useful for studying protein dynamics and interactions in solution.

  • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution without crystallization.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for mapping protein-protein interaction interfaces and conformational changes.

These approaches require highly purified protein, and researchers should consider the challenges of working with membrane proteins. Strategies like the use of detergent micelles, nanodiscs, or amphipols may be necessary to maintain protein stability and native conformation during structural studies.

The choice of expression system is critical for structural studies, with the baculovirus system often preferred for complex proteins: "The baculovirus vector and purification methodology described represent a very powerful system for the large-scale production" of recombinant proteins "which may allow us to undertake structure-function analysis" .

What emerging technologies could advance our understanding of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 function?

Several cutting-edge technologies hold promise for characterizing this uncharacterized protein:

  • CRISPR-Cas9 genome editing: If applicable to C. pneumoniae, could enable precise modification of the gene to study function.

  • Single-cell analysis technologies: May reveal heterogeneity in expression during infection.

  • Proteomics approaches:

    • Thermal proteome profiling (TPP) to identify binding partners and substrates

    • Proximity labeling with BioID or APEX2 to map protein interaction networks in situ

  • Cryo-electron tomography: For visualizing the protein in its native cellular context.

  • AlphaFold2 and other AI-based structure prediction: Can provide structural models even without experimental data.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to place the protein in broader cellular context.

For functional studies that involve monitoring changes in gene expression, researchers should consider methods like those used in C. pneumoniae studies where "relative quantification" using the "ΔΔct-method" has been effectively applied .

How can researchers develop specific antibodies against CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131?

Development of specific antibodies against this protein requires careful consideration of several factors:

  • Antigen preparation options:

    • Full-length recombinant protein: Challenging for membrane proteins

    • Peptide antigens: Select unique, exposed epitopes based on predictive algorithms

    • Extracellular domain expression: If applicable for this protein

  • Antibody production platforms:

    • Polyclonal antibodies: Provide broader epitope recognition

    • Monoclonal antibodies: Higher specificity for defined epitopes

    • Recombinant antibodies: Alternative to traditional hybridoma technology

  • Validation methods:

    • Western blotting against recombinant protein and native protein in bacterial lysates

    • Immunofluorescence in infected cells

    • ELISA for quantitative binding assessment

    • Controls with pre-immune serum and competitor peptides

For optimal specificity, researchers should ensure that antibodies are "specifically immunoreactive with" the target protein, meaning they participate in "a binding reaction between the protein and an antibody which is determinative of the presence of the protein in the presence of a heterogeneous population of proteins and other compounds" .

What vaccination strategies could be explored using CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131?

If CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 proves immunogenic and important for pathogenesis, several vaccination approaches could be explored:

  • Subunit vaccine approaches:

    • Recombinant protein formulation with appropriate adjuvants

    • Selection of immunogenic epitopes if the full protein is not suitable

  • Adjuvant considerations:

    • AS01B-like adjuvants containing "3-O-desacyl-4'-monophosphoryl lipid A (MPL)...and QS-21, a saponin purified from plant extract Quillaja saponaria Molina, combined in a liposomal formulation"

    • Aluminum-based adjuvants for traditional approaches

  • Delivery platforms:

    • Virus-like particles (VLPs) displaying the protein or epitopes

    • mRNA-based vaccines encoding the protein

    • Viral vector vaccines

  • Evaluation metrics:

    • Antibody titers and neutralizing capacity

    • T-cell responses, particularly CD4+ and CD8+ responses

    • Protection in appropriate infection models

Any vaccination strategy would require extensive safety and efficacy testing, recognizing that for research purposes, "all of our products can only be used for research purposes. These vaccine ingredients CANNOT be used directly on humans or animals" .

How does evolutionary pressure on CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 compare with other C. pneumoniae proteins?

Examining evolutionary pressure requires sophisticated comparative genomics approaches:

  • Ka/Ks ratio analysis: Calculate the ratio of non-synonymous to synonymous substitutions to detect selective pressure. Research on other proteins has found significant variation in evolutionary rates - some proteins maintain a "constant relative rate of protein evolution" while others show accelerated evolution .

  • Comparative analysis framework:

Protein CategoryTypical Ka/Ks RangeRepresentative Examples
Highly conservedKa/Ks < 0.1Housekeeping genes
Moderately conserved0.1 < Ka/Ks < 0.5Some membrane proteins
Rapidly evolvingKa/Ks > 0.5Surface-exposed antigens
  • Branch-site models: To detect episodic selection on specific lineages.

  • Structural mapping of variation: Mapping sequence variations onto predicted structures to identify functionally important regions.

Studies of orthologous proteins across species have revealed that "there is a highly significant positive correlation between branch lengths" in phylogenetic trees, suggesting most proteins evolve at relatively constant rates relative to each other . Deviations from this pattern may indicate "changes in a protein's evolutionary rate" which "may reveal cases of change in that protein's function" .

What bioinformatic pipelines can identify distant homologs of CPn_0129/CPn_0130/CP_0642/CPj0130/CpB0131 across bacterial species?

To identify distant homologs across bacterial species, several advanced bioinformatic approaches should be employed:

  • Profile-based searches:

    • PSI-BLAST: Iterative searches that build position-specific scoring matrices

    • HMMER: Hidden Markov Model-based searches against protein databases

  • Structural homology detection:

    • Threading approaches (e.g., Phyre2, I-TASSER)

    • Contact map-based methods

  • Sensitive alignment algorithms:

    • MAFFT or T-Coffee for difficult-to-align sequences

    • Structure-guided alignments when structures are available

  • Context-based methods:

    • Gene neighborhood analysis

    • Phylogenetic profiling

  • Machine learning approaches:

    • Deep learning methods for remote homology detection

    • Feature extraction from sequence and predicted structural properties

When identifying homologs, it's important to recognize that "a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions" . For nucleic acid sequence comparisons, similarity is often established when "the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.