Recombinant Chlamydia trachomatis Deubiquitinase and deneddylase Dub2 (cdu2)

Shipped with Ice Packs
In Stock

Description

Introduction to Chlamydia trachomatis Deubiquitinase Dub2

Chlamydia trachomatis is a gram-negative bacterial pathogen responsible for various significant human diseases, including sexually transmitted urogenital infections and ocular trachoma, a leading cause of preventable blindness worldwide. Despite possessing a relatively small genome, this obligate intracellular pathogen has evolved sophisticated mechanisms to manipulate host cellular processes during infection. One such mechanism involves the expression of specialized enzymes that interfere with the host's ubiquitin system, a critical regulatory pathway controlling numerous cellular functions including protein degradation, cell cycle progression, and immune responses .

Among these specialized enzymes are two deubiquitinating enzymes (DUBs), termed ChlaDUB1 and ChlaDUB2 (also referred to as cdu2). Deubiquitinases are enzymes that remove ubiquitin, a small regulatory protein, from target proteins, thereby reversing the effects of ubiquitination. Similarly, deneddylases remove the ubiquitin-like protein NEDD8 from its conjugated substrates. Through these activities, C. trachomatis can potentially modulate host cell processes to create a favorable environment for its survival and replication .

Molecular Structure and Properties of ChlaDUB2

The crystal structure of the ChlaDUB2 DUB domain has been determined and is classified as a hydrolase enzyme. The structure, registered under the identifier 6MRN in the RCSB Protein Data Bank, provides valuable insights into the molecular architecture of this important virulence factor. The crystallographic data comes from the Chlamydia trachomatis strain L2/434/Bu, which has been extensively studied for its pathogenic properties .

Structural analysis reveals that ChlaDUB2 possesses a catalytic domain with features characteristic of cysteine proteases. The enzyme's active site contains a catalytic triad common to many deubiquitinases, which is essential for its hydrolytic activity. In addition to the standalone structure of ChlaDUB2, researchers have also determined the structure of ChlaDUB2 in complex with ubiquitin propargyl amide (PDB ID: 6OAM), providing critical information about substrate binding and recognition .

The availability of these structural data has been instrumental in understanding the molecular basis of ChlaDUB2's enzymatic activities and has provided a foundation for structure-based investigations of its function and potential inhibition. These structural studies were published by Hausman et al. (2020) in their comprehensive research on the distinct ubiquitin recognition properties of C. trachomatis deubiquitinating enzymes .

Functional Characteristics of ChlaDUB2

ChlaDUB2 exhibits multiple enzymatic activities that distinguish it from other deubiquitinating enzymes. Primary among these is its deubiquitinase (DUB) activity, through which it can cleave ubiquitin from ubiquitinated substrates. Additionally, it possesses deneddylase activity, allowing it to remove the ubiquitin-like protein NEDD8 from neddylated proteins .

Detailed biochemical characterization has revealed interesting aspects of ChlaDUB2's substrate specificity and catalytic efficiency. When tested with the monoubiquitin-based substrate ubiquitin aminomethylcoumarin (Ub-AMC), ChlaDUB2 demonstrated hydrolytic activity comparable to that of ChlaDUB1. This suggests that both enzymes have similar capabilities when processing simple ubiquitin substrates .

Even more striking differences were observed with polyubiquitinated substrates. In experiments using polyubiquitinated green fluorescent protein (GFP-Ub*), ChlaDUB1 efficiently disassembled the polyubiquitin chains into monoubiquitin products. In contrast, while ChlaDUB2 showed activity toward the polyubiquitinated substrate as evidenced by substrate depletion, it did not produce appreciable levels of monoubiquitin product. This observation suggests that ChlaDUB2 may process polyubiquitin chains differently, potentially cleaving at different positions within the chain or exhibiting different chain-type preferences .

These functional distinctions indicate that despite their structural similarities, ChlaDUB1 and ChlaDUB2 likely play different roles during C. trachomatis infection, potentially targeting different host substrates or pathways.

Comparative Analysis of ChlaDUB1 and ChlaDUB2

Although ChlaDUB1 and ChlaDUB2 were initially presumed to have redundant functions due to similarities in their catalytic domains, research has revealed significant differences in their enzymatic properties and substrate preferences. Table 1 summarizes these key differences:

Table 1: Comparative Properties of ChlaDUB1 and ChlaDUB2

FeatureChlaDUB1ChlaDUB2
Monoubiquitin substrate (Ub-AMC) hydrolysisEfficientEfficient
Diubiquitin substrate hydrolysisRapid (similar to SdeA)Inefficient
Polyubiquitinated substrate (GFP-Ub*) processingEfficiently disassembles chains into monoubiquitinDepletes substrate but doesn't produce appreciable monoubiquitin
Distal ubiquitin bindingEquivalent to ChlaDUB2Equivalent to ChlaDUB1
Proposed mechanism for differential activityN/ADifferent recognition of substrates involving additional ubiquitin binding sites

ChlaDUB1 efficiently cleaves diubiquitin substrates, exhibiting activity similar to that of SdeA, a well-characterized prokaryotic DUB. In contrast, ChlaDUB2 shows poor activity toward diubiquitin, indicating limitations in its ability to process this type of substrate .

These differences in substrate specificity and processing mechanisms indicate that ChlaDUB1 and ChlaDUB2 likely target different host substrates and potentially serve distinct functions during C. trachomatis infection. This functional specialization may explain why the pathogen maintains both enzymes despite the energetic cost of expressing two seemingly similar proteins in its limited genome .

Role in Chlamydia trachomatis Pathogenesis

The presence of specialized deubiquitinating enzymes like ChlaDUB2 in the relatively small genome of C. trachomatis suggests that these enzymes play critical roles in the pathogen's life cycle and virulence. As an obligate intracellular bacterium, C. trachomatis must effectively manipulate host cell processes to establish and maintain its replicative niche while evading host defense mechanisms .

The ubiquitin and ubiquitin-like protein systems regulate numerous cellular processes, including protein degradation, signal transduction, endocytosis, and immune responses. By expressing enzymes that can modify these systems, C. trachomatis can potentially influence host cell functions to create an environment conducive to its survival and replication .

ChlaDUB2's deubiquitinating activity may allow the pathogen to counteract host ubiquitination events directed at bacterial proteins or structures as part of defense mechanisms. Additionally, by modifying the ubiquitination status of host proteins, C. trachomatis could potentially alter cellular signaling pathways, subvert immune responses, or modulate other aspects of host cell biology .

The deneddylase activity of ChlaDUB2 adds another dimension to its potential role in pathogenesis. NEDD8 conjugation (neddylation) regulates the activity of cullin-RING ligases, which are involved in ubiquitin-mediated protein degradation. By interfering with neddylation, ChlaDUB2 could indirectly affect various cellular processes controlled by cullin-RING ligases .

Studies on different C. trachomatis serovars have shown variation in genomic content and protein expression patterns, which may influence virulence and tissue tropism. These variations could potentially affect the expression or activity of virulence factors like ChlaDUB2, contributing to differences in disease manifestation between ocular and genital strains .

Research Applications and Future Directions

The study of ChlaDUB2 and other bacterial deubiquitinases represents an active area of research with implications for understanding bacterial pathogenesis and developing novel antimicrobial strategies. Current and future research applications of recombinant ChlaDUB2 include:

Identification of host substrates is a critical research direction. Determining which host proteins are specifically targeted by ChlaDUB2 during infection would provide insights into the molecular mechanisms of C. trachomatis pathogenesis. Proteomic approaches comparing ubiquitination patterns in infected versus uninfected cells, or in cells exposed to active versus inactive ChlaDUB2, could help identify relevant substrates .

Development of specific inhibitors represents another promising avenue. The unique structural and functional properties of ChlaDUB2 make it a potential target for developing specific inhibitors that could interfere with C. trachomatis infection. High-throughput screening of chemical libraries using recombinant ChlaDUB2 could identify lead compounds for further development .

Investigation of enzyme regulation during the C. trachomatis developmental cycle could provide insights into the temporal aspects of host-pathogen interactions. This includes studying expression patterns, potential post-translational modifications, and interactions with other bacterial or host proteins .

Structure-function studies building on existing structural data could further elucidate the molecular basis of ChlaDUB2's substrate specificity and catalytic mechanism. Mutational studies guided by structural information could identify critical residues for various aspects of enzyme function .

Vaccine development research may also benefit from understanding ChlaDUB2's role in pathogenesis. While current vaccine efforts have focused primarily on the major outer membrane protein (MOMP) of C. trachomatis, enzymes like ChlaDUB2 that contribute to virulence could potentially serve as alternative or complementary vaccine targets .

The continued study of ChlaDUB2 and related bacterial deubiquitinases promises to enhance our understanding of host-pathogen interactions and potentially lead to new strategies for preventing or treating Chlamydia infections. As research tools and techniques continue to evolve, we can anticipate more detailed insights into the structure, function, and biological roles of this fascinating enzyme.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdu2; CT_867; Deubiquitinase and deneddylase Dub2; ChlaDub2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
cdu2
Target Protein Sequence
MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLL DADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPL TKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYDYIASPQQMREQLEGLA ASLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Uniprot No.

Target Background

Function
Effector proteins play a crucial role in modulating host cell physiology and promoting bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities.
Database Links

KEGG: ctr:CT_867

Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Q&A

What is Chlamydia trachomatis Deubiquitinase and deneddylase Dub2 (cdu2) and what is its significance in bacterial pathogenesis?

Chlamydia trachomatis Deubiquitinase and deneddylase Dub2 (cdu2), also known as ChlaDUB2, is one of two deubiquitinating enzymes expressed by Chlamydia trachomatis, an obligate intracellular pathogen responsible for sexually transmitted infections and ocular trachoma. Despite possessing a relatively small genome, C. trachomatis produces both ChlaDUB1 and ChlaDUB2, suggesting these enzymes play critical roles in bacterial survival and pathogenesis . These enzymes function to remove ubiquitin from host cell proteins, thereby interfering with host ubiquitin-dependent processes that would otherwise restrict bacterial replication or trigger immune responses. ChlaDUB2's significance lies in its ability to modify host cell signaling pathways through targeted deubiquitination, potentially contributing to the establishment and maintenance of the chlamydial inclusion (the membrane-bound vacuole in which the bacteria replicate) . The expression of these specialized enzymes represents a sophisticated bacterial adaptation to subvert host defense mechanisms and create a favorable environment for bacterial growth within infected cells .

What experimental methods are commonly used to study the enzymatic activity of ChlaDUB2?

Several complementary methodologies are employed to characterize the enzymatic activity of ChlaDUB2. The most common approach involves using fluorogenic substrates such as ubiquitin aminomethylcoumarin (Ub-AMC), where ubiquitin is conjugated to AMC, a fluorescent leaving group that is released upon cleavage by a deubiquitinating enzyme . This assay provides a direct measurement of deubiquitinase activity through increased fluorescence. For studying activity against more complex substrates, researchers employ di-ubiquitin cleavage assays where the enzyme's ability to hydrolyze different ubiquitin chain linkages (K48, K63, etc.) is assessed using gel-based separation methods followed by western blotting . Polyubiquitinated green fluorescent protein (GFP-Ubn) substrates are also utilized to examine activity against longer ubiquitin chains in a setting that more closely mimics physiological substrates . Additionally, researchers use site-directed mutagenesis to identify catalytic residues and create activity-deficient mutants for control experiments. For structural studies, X-ray crystallography has been employed to determine the three-dimensional structure of the ChlaDUB2 DUB domain alone and in complex with ubiquitin propargyl amide, providing insights into substrate binding mechanisms . These methodologies collectively enable a comprehensive characterization of ChlaDUB2's enzymatic properties and substrate preferences.

How do the substrate specificities of ChlaDUB1 and ChlaDUB2 differ, and what are the implications for their biological roles?

Recent research has uncovered marked differences in substrate preferences between ChlaDUB1 and ChlaDUB2, challenging the previous assumption that they serve redundant functions . Experimental evidence demonstrates that while both enzymes exhibit similar efficiency in cleaving monoubiquitin-based substrates like Ub-AMC, they differ substantially in their activities toward di- and polyubiquitin chains . ChlaDUB1 efficiently hydrolyzes diubiquitin substrates and disassembles polyubiquitin chains into monoubiquitin products, similar to the activity observed with the prokaryotic DUB SdeA . In contrast, ChlaDUB2 shows significantly reduced efficiency in cleaving diubiquitin substrates . When tested against polyubiquitinated GFP (GFP-Ubn), ChlaDUB2 depletes the substrate but produces minimal monoubiquitin, suggesting a distinct mechanism of action compared to ChlaDUB1 . These differential activities likely reflect specialized biological roles during infection. ChlaDUB1 may function predominantly in broadly counteracting host ubiquitination responses, while ChlaDUB2 might target specific host proteins with particular ubiquitin modifications. This functional specialization could allow C. trachomatis to fine-tune its manipulation of host cellular processes, optimizing conditions for bacterial survival and replication within different cellular compartments or at different stages of the infection cycle .

What is the role of ChlaDUB2 in modulating host immune responses during Chlamydia trachomatis infection?

ChlaDUB2 appears to play a crucial role in modulating host immune responses during C. trachomatis infection, although its specific targets and mechanisms are still being elucidated. By analogy with the better-characterized ChlaDUB1, which has been shown to deubiquitinate and stabilize the apoptosis regulator Mcl-1 at the chlamydial inclusion membrane, ChlaDUB2 likely targets distinct host proteins involved in immune signaling pathways . Experimental evidence indicates that deubiquitinating enzymes from Chlamydia help the pathogen evade host defense mechanisms, particularly interferon-gamma (IFNγ)-mediated responses. When the related enzyme Cdu1 is inactivated, C. trachomatis shows increased sensitivity to IFNγ and impaired infection capability in mouse models, suggesting a critical role for these enzymes in immune evasion . While the specific immune modulatory functions of ChlaDUB2 require further investigation, its deubiquitinating activity likely contributes to suppressing host inflammatory responses, preventing premature cell death of infected cells, or interfering with immune recognition. The differential substrate specificity observed between ChlaDUB1 and ChlaDUB2 suggests that each enzyme may target distinct components of the host immune system, allowing for multifaceted manipulation of defense mechanisms to promote bacterial persistence and transmission .

What are the current approaches for developing selective inhibitors of ChlaDUB2, and how might these advance therapeutic strategies against Chlamydia trachomatis infections?

The development of selective inhibitors targeting ChlaDUB2 represents a promising approach for novel anti-chlamydial therapeutics. Current strategies leverage the structural information obtained from crystallographic studies of the ChlaDUB2 DUB domain (PDB ID: 6MRN) and its complex with ubiquitin propargyl amide . Structure-based drug design efforts focus on identifying compounds that can bind to the unique features of the ChlaDUB2 catalytic site, particularly the substrate-binding pocket that differs from both mammalian DUBs and ChlaDUB1 . Virtual screening approaches utilizing the crystal structure have enabled researchers to identify candidate small molecules that may selectively inhibit ChlaDUB2 activity. These potential inhibitors are then evaluated through biochemical assays using purified recombinant ChlaDUB2 and fluorogenic substrates to assess their potency and selectivity. Promising candidates are further tested in cellular infection models to determine their efficacy in reducing bacterial loads and their ability to potentiate host immune responses against C. trachomatis. The identification of selective ChlaDUB2 inhibitors could lead to novel therapeutic agents that specifically target chlamydial infection while minimizing effects on human deubiquitinases, potentially offering advantages over conventional antibiotics in terms of reduced resistance development and fewer side effects. Moreover, such inhibitors would serve as valuable research tools to further elucidate the specific functions of ChlaDUB2 in chlamydial pathogenesis .

What are the optimal conditions for expressing and purifying recombinant ChlaDUB2 for enzymatic studies?

The successful expression and purification of enzymatically active recombinant ChlaDUB2 requires careful optimization of multiple parameters. Based on published protocols, the most effective expression system for ChlaDUB2 involves using Escherichia coli BL21(DE3) cells transformed with a plasmid containing the ChlaDUB2 catalytic domain (typically residues 230-339) fused to an N-terminal affinity tag such as 6×His or GST . Expression is optimally induced with 0.5 mM IPTG when cultures reach an OD600 of 0.6-0.8, followed by incubation at a reduced temperature of 18°C for 16-18 hours to promote proper protein folding . For purification, a multi-step approach yields the highest purity and activity: initial capture using affinity chromatography (Ni-NTA for His-tagged proteins), followed by tag cleavage using a site-specific protease (e.g., TEV protease), and final polishing via size exclusion chromatography . Throughout the purification process, it's critical to maintain reducing conditions (typically 1-5 mM DTT or 2 mM β-mercaptoethanol) to protect the catalytic cysteine residue from oxidation. The optimal buffer system consists of 50 mM Tris-HCl pH 7.5-8.0, 150 mM NaCl, 5% glycerol, and 1 mM EDTA . For long-term storage, the purified enzyme should be flash-frozen in liquid nitrogen and stored at -80°C in small aliquots to avoid repeated freeze-thaw cycles. Activity assays using Ub-AMC should be performed immediately after thawing to confirm that the enzyme has retained its catalytic function prior to use in experimental studies .

How can researchers effectively differentiate between the deubiquitinase and deneddylase activities of ChlaDUB2 in experimental settings?

Differentiating between the deubiquitinase and deneddylase activities of ChlaDUB2 requires specialized experimental approaches that can selectively monitor each function. The following methodological framework enables researchers to assess these distinct activities:

Activity TypeSubstrateDetection MethodControlsData Analysis
DeubiquitinaseUb-AMC, di-Ub chains (K48, K63, etc.), poly-Ub proteinsFluorescence measurement (Ub-AMC), SDS-PAGE/Western blot (di/poly-Ub)USP2 (positive control), catalytic mutant ChlaDUB2 (negative control)Initial velocity, Km, kcat determination
DeneddylaseNEDD8-AMC, neddylated cullinsFluorescence measurement (NEDD8-AMC), SDS-PAGE/Western blot (neddylated proteins)NEDP1 (positive control), catalytic mutant ChlaDUB2 (negative control)Initial velocity, Km, kcat determination
ComparativeEqual molar concentrations of Ub-AMC and NEDD8-AMCParallel fluorescence assaysEnzyme with known preferences (e.g., USP21 or NEDP1)Activity ratios (DUB:deneddylase)

To specifically assess deneddylase activity, researchers can use neddylated cullins (particularly Cullin1 and Cullin3) as physiologically relevant substrates . The reaction products can be separated by SDS-PAGE and visualized by western blotting using anti-NEDD8 antibodies to quantify deneddylation . Competition assays, where both ubiquitin and NEDD8 substrates are present, can reveal preferential activity. Researchers should also employ specific inhibitors: for instance, treating samples with the NEDD8-activating enzyme inhibitor MLN4924 can help distinguish whether observed effects stem from inhibition of neddylation or active deneddylation by ChlaDUB2 . Site-directed mutagenesis targeting residues predicted to differentially interact with ubiquitin versus NEDD8 can further elucidate the structural determinants of substrate specificity. Finally, cellular assays measuring the global neddylation state in the presence of wild-type versus catalytically inactive ChlaDUB2 provide insights into the physiological relevance of its deneddylase activity in the context of chlamydial infection .

What cell-based assays are most appropriate for investigating the functional impacts of ChlaDUB2 during Chlamydia trachomatis infection?

Several complementary cell-based assays provide comprehensive insights into ChlaDUB2's functional roles during C. trachomatis infection. Infection models using epithelial cell lines (HeLa, HEp-2) are fundamental platforms for studying ChlaDUB2's impact on bacterial development and host responses . To directly assess ChlaDUB2's functions, researchers can employ transfection approaches to express wild-type or catalytically inactive mutants in host cells prior to infection, or use bacterial genetic systems to generate ChlaDUB2 deletion/insertion mutants or complemented strains . Confocal microscopy with immunofluorescence staining for inclusion membrane markers, ubiquitin, and NEDD8 enables visualization of ChlaDUB2 localization and its effects on protein modification patterns around the inclusion . For quantitative assessment of infection outcomes, inclusion size measurement, bacterial progeny quantification through infectious unit assays, and host cell viability assessment provide critical metrics of ChlaDUB2's contribution to chlamydial fitness . To investigate specific host pathways affected by ChlaDUB2, researchers can monitor NF-κB activation using reporter assays, analyze inflammatory cytokine production via ELISA or qPCR, and assess apoptosis markers through flow cytometry or western blotting . Proteomics approaches including ubiquitin remnant profiling enable unbiased identification of host proteins whose ubiquitination status is altered by ChlaDUB2 activity . Additionally, cell-based assays examining host responses to stress, including IFNγ stimulation and nutrient restriction, can reveal ChlaDUB2's role in bacterial adaptation to hostile conditions . For highest physiological relevance, validation studies in polarized epithelial cells or primary cell models that better represent natural infection sites should complement findings from conventional cell lines .

How should researchers interpret differences in ChlaDUB2 activity against various ubiquitin chain types and what are the implications for target identification?

Interpreting ChlaDUB2's differential activity against various ubiquitin chain types requires careful consideration of both the enzymological data and the biological context. Recent studies have revealed that ChlaDUB2 exhibits distinct preferences in processing different ubiquitin linkages, which has significant implications for identifying its physiological targets . When analyzing enzymatic assays with di- and polyubiquitin chains, researchers should evaluate both the depletion rate of the substrate and the accumulation pattern of reaction products. ChlaDUB2's reduced efficiency in processing diubiquitin compared to ChlaDUB1, combined with its distinct pattern of polyubiquitin chain processing (where it depletes substrate but produces minimal monoubiquitin), suggests a specialized function rather than a general deubiquitinase role . This activity profile implies that ChlaDUB2 may preferentially target specific host proteins modified with particular ubiquitin chain configurations. To identify potential targets, researchers should focus on host proteins known to be regulated by the types of ubiquitin chains that ChlaDUB2 shows activity against, particularly those involved in immune signaling, cell death regulation, or vesicular trafficking that would benefit bacterial survival . Proteomic approaches comparing the ubiquitinome of cells infected with wild-type bacteria versus ChlaDUB2-deficient strains can reveal physiological substrates. When interpreting such data, proteins showing increased ubiquitination in the absence of ChlaDUB2 represent potential direct targets, particularly those localized near the inclusion membrane where ChlaDUB2 is likely to exert its function . The chain-type specificity should guide researchers toward understanding the specific cellular pathways being manipulated during infection rather than assuming broad deubiquitination activity.

What statistical approaches and controls are essential when comparing the enzymatic properties of ChlaDUB1 and ChlaDUB2?

Experimental AspectStatistical ApproachEssential ControlsConsiderations
Enzyme KineticsMichaelis-Menten analysis (Km, kcat, kcat/Km determination)
Non-linear regression fitting
- Catalytically inactive mutants (C/A substitution)
- No-enzyme controls
- Known DUBs (USP2, UCH-L3) as positive controls
- Ensure substrate concentration range spans Km
- Verify reactions remain in linear range
- Account for substrate depletion effects
Substrate SpecificityTwo-way ANOVA with post-hoc tests
Relative activity ratios with 95% confidence intervals
- Equal enzyme concentrations confirmed by active site titration
- Parallel assays with identical conditions
- Normalize data to account for intrinsic differences in substrate properties
- Include enzymes with known preferences as benchmarks
Time-Course AnalysisArea-under-curve comparisons
Reaction rate constants determination
- Time-zero samples
- Heat-inactivated enzyme controls
- Multiple time points required (minimum 6-8)
- Consider product inhibition effects
Structural ComparisonsStatistical analysis of binding energy calculations
Residue conservation scoring
- Mock docking with random proteins
- Comparison with human DUB structures
- Account for conformational flexibility
- Consider solution vs. crystal structure differences

For enzyme kinetic studies, each experiment should be performed with at least three technical replicates and three independent biological preparations of each enzyme . When comparing activity across different substrates, the use of substrate concentration-matched experiments is critical to avoid bias. For cellular studies, appropriate statistical tests (typically Student's t-test for pairwise comparisons or ANOVA for multiple conditions) with corrections for multiple comparisons should be employed . Power analysis should guide sample size determination to ensure sufficient statistical power (typically ≥0.8) for detecting biologically meaningful differences. Researchers should clearly report whether parametric assumptions were met and utilize non-parametric alternatives when appropriate. Finally, effect sizes (Cohen's d or similar metrics) should be reported alongside p-values to communicate the magnitude of observed differences between ChlaDUB1 and ChlaDUB2 enzymatic properties .

How can researchers effectively analyze the impact of ChlaDUB2 on global ubiquitination and neddylation patterns in infected cells?

Analyzing ChlaDUB2's impact on global ubiquitination and neddylation patterns in infected cells requires sophisticated methodological approaches that integrate cellular, biochemical, and computational techniques. To comprehensively assess these modifications, researchers should employ quantitative proteomics using tandem mass tag (TMT) or stable isotope labeling with amino acids in cell culture (SILAC) approaches combined with ubiquitin/NEDD8 remnant profiling . This methodology involves enriching peptides containing the characteristic diglycine remnant left after tryptic digestion of ubiquitinated or neddylated proteins. By comparing cells infected with wild-type C. trachomatis versus ChlaDUB2-deficient strains, researchers can identify proteins whose modification status is specifically affected by ChlaDUB2 activity . Complementary to proteomics, immunoblotting analysis using antibodies specific for ubiquitin or NEDD8 provides a global view of modification changes, while targeted analyses of candidate substrates can verify proteomics findings . Time-course experiments are essential to capture dynamic changes in modification patterns throughout the developmental cycle of C. trachomatis. For spatial resolution, proximity labeling approaches such as BioID or TurboID with ChlaDUB2 as the bait can identify proteins in close proximity to ChlaDUB2, enriching for potential substrates . Computational analysis of the resulting datasets should include pathway enrichment analysis to identify biological processes affected by ChlaDUB2, and motif analysis to potentially uncover recognition sequences for ChlaDUB2 targeting . Validation studies should employ site-directed mutagenesis of putative ubiquitination/neddylation sites in candidate substrates to confirm direct effects. Additionally, super-resolution microscopy can visualize the co-localization of ChlaDUB2 with ubiquitinated or neddylated substrates at the inclusion membrane, providing spatial context for the proteomic findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.