Recombinant Chlamydia trachomatis DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Description

Biological Role in C. trachomatis Cell Division

In C. trachomatis, FtsK compensates for the absence of FtsZ by initiating divisome assembly through polarized budding. Key findings include:

Localization and Divisome Assembly

  • Discrete Foci Formation: FtsK forms foci at the septum and the base of progenitor mother cells, marking nascent divisome sites .

  • Hierarchical Recruitment: FtsK is recruited before other divisome proteins, such as PBP2/PBP3 (penicillin-binding proteins) and MreB/MreC, which are involved in peptidoglycan synthesis and structural support .

  • MreB Dynamics: Unlike FtsZ, MreB is recruited late to the divisome and is essential for septal peptidoglycan ring formation .

Functional Knockdown Experiments

CRISPRi-mediated knockdown of ftsK disrupts divisome assembly, leading to:

  • Aberrant Morphology: Enlarged, non-dividing C. trachomatis cells with reduced septal peptidoglycan synthesis .

  • Transcript Reduction: ~10-fold decrease in ftsK mRNA levels, confirming specificity .

Domain Function Comparison

DomainC. trachomatis FtsKE. coli FtsK
N-Terminus4 TM helices (34% identity) 4 TM helices (membrane anchor)
C-TerminusDNA translocase motor (41% identity)Hexameric ATP-dependent motor

DNA Translocation Mechanism

  • Hexameric Assembly: The C-terminal domain forms hexameric rings that translocate DNA bidirectionally via a rotary inchworm mechanism .

  • Chromosome Resolution: Activates XerCD recombinase at the dif site to resolve chromosome dimers, ensuring proper segregation .

Research Applications and Experimental Tools

Recombinant FtsK enables:

  • Localization Studies: Antibody-based imaging of FtsK foci in infected HeLa cells .

  • Biochemical Assays: Testing DNA translocation activity in vitro .

  • Therapeutic Targeting: Exploring FtsK inhibitors to disrupt C. trachomatis divisome assembly .

Key Research Findings

StudyMethodologyOutcome
Localization in C. trachomatisImmunofluorescence in HeLa cellsFtsK foci mark nascent divisome sites
CRISPRi KnockdownftsK-targeting crRNA + dCas12~10-fold reduction in ftsK mRNA; cell division arrest
Domain Function AnalysisSequence alignment + structural biologyN-terminus directs membrane localization; C-terminus drives DNA translocation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please specify your needs when placing your order, and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the liquid form has a shelf life of 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
ftsK; CT_739; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-799
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
ftsK
Target Protein Sequence
MGKERKKASVSLSPQTVFAVKTCVYLALACFSGLSLWSFQHNQPYTQNWIGLLGWSLSSF LLYNFGVAAFLIPLNFGWLSFLNMKRTPAPLAFRKAAAFGAIPVCCAVLLSMISPAQNLP QFLATRVPMVVMDLQPPKAYLGGIPFYLLYDGNSFSLKLLIGAVGTGLIFLAILLCAIFY LIPKSFVLKKKALLDDLLKFLKNKFYACWNACKKLLKNLVNNKSYVPKPSLRVPSSPSVA KKEMLKLPTPVISLPLENKDLHDDSSVNRTIFLTPPHPTKRTLSPQKRTDLPNLLPKDSA LAPAQTSYKPLPTPSPFVLAGDAPDLPQYHLLSKRNVHRPESLLEELKKKAAILQQTLAS FGIEAAIGNICSGPTLAAFEVLPNTGVKVQKIKALENDIALNLQASSIRIIAPIPGKAAV GIEIPNPDPQPVNFRDLLEDYQKGTQRLQVPLLLGKKANGDNFWTDLATMPHLIIAGTTG SGKSVCINTIVMSLIMTSPPTDIKLVIVDPKKVELTGYSQLPHMLTPVITESKEAHSALI WLVREMELRYEILRFLGLRNIQSFNSRTRNVDIEASYDKEISEKMPFIVGIIDELSDLLL SSSHDIETPIVRLAQMARAVGIHLILATQRPSRDVITGLIKANFPSRIAFKVANKVNSQI IIDEPGAENLMGNGDMLVVSPGSFAPVRVQGAYICDDDINKVIKDLCSRFPCKYVIPSFN TYDDPGSMDPEDLDPLFNQAKTLVLQTGNASTTFLQRKLKIGYARAASIIDQLEEARIVG PSEGAKPRQILVQLSNQDD
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell-division machinery. The C-terminus acts as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. It is crucial for activating the Xer recombinase, thereby enabling chromosome unlinking through recombination.
Database Links

KEGG: ctr:CT_739

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of FtsK in Chlamydia trachomatis cell division?

FtsK in Chlamydia trachomatis (Ct) serves as a critical initiator of divisome assembly in the absence of FtsZ. Unlike in other bacteria where FtsZ forms the central scaffold for cell division, chlamydial FtsK forms discrete foci at the septum and at the base of the progenitor mother cell. These FtsK foci at the base of the mother cell mark the location of nascent divisome complexes that will form at the site where a daughter cell will emerge in the next round of division. FtsK is recruited to nascent divisomes prior to other chlamydial divisome proteins, including the PBP2 and PBP3 transpeptidases, and MreB and MreC proteins .

How does FtsK localization in Chlamydia trachomatis differ from other bacteria?

  • Foci at the septum

  • Foci at both the septum and the base of the progenitor mother cell

  • Foci at the base of the progenitor mother cell only

The chlamydial FtsK foci observed during cell division are not uniformly distributed at the septum but are restricted to one side of the MOMP-stained septum. Additionally, the FtsK foci are often offset relative to the plane defined by MOMP staining at the septum .

What are the recommended approaches for expressing recombinant Chlamydia trachomatis FtsK protein?

Recombinant FtsK from Chlamydia trachomatis can be expressed using several expression systems:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionMay lack proper post-translational modifications
YeastBetter for eukaryotic protein foldingLonger expression time than E. coli
BaculovirusGood for larger proteins, proper foldingMore complex system to establish
Mammalian cellsBest for mammalian protein authenticityLower yields, more expensive

The most common approach is E. coli expression with an N-terminal His-tag for purification. When expressing the full-length protein (1-799 amino acids), it is recommended to optimize codon usage for the expression host and to consider using specialized E. coli strains designed for membrane protein expression if the N-terminal transmembrane domains are included .

How can researchers effectively visualize FtsK localization in Chlamydia trachomatis?

To visualize FtsK localization in Chlamydia trachomatis, researchers have successfully employed several complementary approaches:

  • Antibody-based detection of endogenous FtsK:

    • Infect HeLa cells with Ct

    • Harvest bacteria from infected cells (typically at 21 hours post-infection)

    • Fix and stain with anti-FtsK antibody and anti-MOMP (major outer membrane protein) antibody

    • Use confocal or super-resolution microscopy for imaging

  • Fluorescent protein fusion approach:

    • Transform Ct with a plasmid encoding FtsK-mCherry fusion under an inducible promoter

    • Induce expression at ~19 hours post-infection

    • Harvest bacteria at ~21 hours post-infection

    • Fix and stain with MOMP antibody

    • Visualize using fluorescence microscopy

  • Quantitative analysis:

    • Score cells for different FtsK localization patterns (septal foci, base foci, or both)

    • Correlate localization with cell division stages

The use of MOMP as a membrane marker helps define the cell boundary and septum, providing context for FtsK localization. When planning these experiments, it's important to note that overexpression of FtsK-mCherry fusion has been shown not to affect chlamydial developmental cycle progression or production of infectious elementary bodies .

What methods are effective for studying FtsK function through gene knockdown in Chlamydia trachomatis?

CRISPR interference (CRISPRi) has proven effective for studying FtsK function in Chlamydia trachomatis. The methodological approach includes:

  • Design and implementation:

    • Generate a strain expressing dCas12 (catalytically dead Cas12) under an inducible promoter

    • Design crRNA targeting the ftsK gene

    • Transform Chlamydia with the constructs

  • Induction protocol:

    • Infect host cells with the transformed Chlamydia

    • Induce dCas12 expression with anhydrotetracycline (aTc) at specific timepoints:

      • Early induction (4 hours post-infection) to observe developmental effects

      • Late induction (17 hours post-infection) for transient knockdown to study protein localization

  • Validation of knockdown:

    • RT-qPCR to measure reduction in ftsK transcript levels (expected ~10-fold reduction)

    • Immunofluorescence to verify reduction of FtsK protein

    • Include controls targeting other genes (e.g., pbp2) and non-targeted genes (e.g., euo, omcB)

  • Phenotypic analysis:

    • Microscopy to observe morphological changes (enlarged aberrant morphology is expected)

    • Immunostaining for other divisome components to assess divisome assembly

    • Peptidoglycan labeling to evaluate septal peptidoglycan synthesis

This approach has demonstrated that knocking down FtsK prevents divisome assembly, inhibits cell division, and blocks septal peptidoglycan synthesis, confirming its essential role in chlamydial cell division .

How does the absence of FtsZ in Chlamydia trachomatis affect the role and importance of FtsK in divisome assembly?

The absence of FtsZ in Chlamydia trachomatis has led to a fundamentally different divisome assembly pathway compared to most bacteria:

  • Altered divisome hierarchy:
    In most bacteria, FtsZ polymerizes to form the Z-ring, which serves as a scaffold for divisome assembly, with FtsK being a mid-to-late recruit. In Chlamydia, FtsK appears to be one of the earliest divisome proteins recruited, functioning as an initiator rather than a downstream component .

  • Hybrid divisome composition:
    Chlamydia's divisome contains elements of both traditional divisome and elongasome components from other bacteria. This hybrid nature likely evolved as an adaptation to the absence of FtsZ, with FtsK taking on expanded functions .

  • Spatial organization:
    Without FtsZ to define the division plane, FtsK localization appears to play a crucial role in marking future division sites. The discrete focal pattern of FtsK, rather than the uniform distribution seen in other bacteria, suggests it may serve as a positional marker for divisome assembly .

  • Temporal coordination:
    FtsK is recruited to nascent divisomes prior to other divisome proteins including PBP2, PBP3, MreB, and MreC. This early recruitment is essential for the subsequent assembly of the complete divisome complex .

These findings indicate that in the absence of FtsZ, Chlamydia has evolved to use FtsK as a critical organizing factor for divisome assembly, highlighting the plasticity of bacterial cell division systems and the potential adaptability of divisome components to fulfill different roles when key components are absent .

What is the relationship between FtsK activity and peptidoglycan synthesis in Chlamydia trachomatis?

The relationship between FtsK activity and peptidoglycan (PG) synthesis in Chlamydia trachomatis reveals a complex coordination of cell division processes:

  • Coordinated recruitment of peptidoglycan synthetic machinery:
    FtsK is required for the proper recruitment and localization of peptidoglycan synthetic enzymes, including PBP2 and PBP3 transpeptidases. When FtsK is knocked down, these enzymes fail to localize properly at the division site .

  • Regulation of septal peptidoglycan formation:
    Knockdown of FtsK inhibits septal peptidoglycan synthesis, suggesting that FtsK activity is upstream of and necessary for the activation of PG synthesis machinery at the division site .

  • Integration with other divisome components:
    FtsK appears to coordinate the activities of MreB (typically associated with elongation in rod-shaped bacteria) with divisome components. In Chlamydia, MreB is one of the last proteins recruited to the divisome and is necessary for the formation of septal PG rings .

  • Temporal sequence:
    The data indicates a temporal sequence where:

    • FtsK localizes to future division sites

    • FtsK facilitates recruitment of PBP2, PBP3, and other divisome components

    • MreB is recruited last

    • Septal PG synthesis occurs once the divisome is fully assembled

This relationship demonstrates that FtsK serves as a critical link between divisome assembly and the activation of peptidoglycan synthetic machinery in Chlamydia trachomatis, ensuring that cell wall synthesis is coordinated with other aspects of cell division .

How does cardiolipin synthesis relate to FtsK function and divisome assembly in Chlamydia trachomatis?

Recent studies have revealed a significant relationship between cardiolipin (CL) synthesis, FtsK function, and divisome assembly in Chlamydia trachomatis:

  • Spatial coordination:
    Cardiolipin is concentrated at the poles and septum of Chlamydia cells, which coincides with the localization patterns of FtsK. This suggests a potential role for cardiolipin in creating membrane microdomains that facilitate FtsK recruitment or activity .

  • Membrane curvature effects:
    The unique structure of cardiolipin helps induce membrane curvature, which may be necessary for the proper formation of the division septum. This membrane remodeling likely creates an environment conducive to the recruitment and function of divisome proteins, including FtsK .

  • MreB recruitment:
    Cardiolipin promotes the recruitment of MreB during polarized cell division. Since FtsK is upstream of MreB recruitment in the divisome assembly pathway, this suggests a potential cascade where:

    • Cardiolipin establishes membrane domains at future division sites

    • FtsK is recruited to these domains

    • FtsK facilitates subsequent recruitment of other divisome components including MreB

    • MreB ultimately contributes to septal PG synthesis

  • Evolutionary adaptation:
    The relationship between cardiolipin, FtsK, and divisome assembly appears to be part of Chlamydia's evolutionary adaptation to divide without FtsZ. In this adapted system, membrane composition and curvature may play more prominent roles in defining division sites than in bacteria that utilize FtsZ .

This integrated understanding suggests that proper FtsK function in Chlamydia is dependent on lipid microenvironments established by cardiolipin, highlighting the complex interplay between membrane composition, protein localization, and cell division machinery in this unique bacterial system .

What are the implications of FtsK research in Chlamydia trachomatis for antimicrobial development?

Research on FtsK in Chlamydia trachomatis offers several promising avenues for antimicrobial development:

  • Novel target identification:
    FtsK represents a potentially attractive antimicrobial target due to:

    • Its essential role in chlamydial cell division

    • Its unique functions in Chlamydia compared to other bacteria

    • The absence of FtsZ in Chlamydia, which is a common target in other bacteria

  • Selective inhibition potential:
    The distinct role and structural features of chlamydial FtsK may allow for the development of inhibitors that selectively target Chlamydia without disrupting commensal bacteria that rely primarily on FtsZ-mediated division.

  • Disruption strategies:
    Several approaches could be pursued:

    ApproachMechanismAdvantage
    ATPase domain inhibitorsBlock the ATPase activity of FtsKTarget a conserved function essential for activity
    Localization disruptorsPrevent proper FtsK localizationMay offer high specificity for chlamydial FtsK
    Protein-protein interaction inhibitorsBlock interactions with other divisome componentsCould be highly selective for chlamydial systems
    Cardiolipin interaction disruptorsInterfere with membrane domain formationNovel approach targeting membrane-protein interactions
  • Combination therapy potential:
    Understanding the relationship between FtsK, peptidoglycan synthesis, and cardiolipin may enable development of combination therapies that target multiple aspects of the chlamydial cell division machinery simultaneously, potentially reducing the risk of resistance development .

The unique nature of cell division in Chlamydia trachomatis, with FtsK playing a central role, provides opportunities for developing targeted antimicrobials that could be effective against this pathogen while minimizing disruption to the host microbiome.

How can researchers develop improved experimental models to study FtsK function in the context of host-pathogen interactions?

Developing improved experimental models to study FtsK function in host-pathogen contexts requires innovative approaches that bridge molecular microbiology with infection biology:

  • Advanced cell culture systems:

    • Polarized epithelial cell models that better mimic natural infection sites

    • 3D organoid cultures of reproductive or ocular tissue to study tissue-specific aspects

    • Co-culture systems incorporating immune cells to assess how FtsK function and division rate affect immune recognition

  • Genetic manipulation strategies:

    • Conditional expression systems for FtsK and other divisome components

    • Fluorescent protein tagging at endogenous loci using CRISPR-based genome editing

    • Domain-specific mutations to dissect functional regions of FtsK

  • Live imaging approaches:

    • Development of minimally disruptive fluorescent tags for real-time imaging

    • Super-resolution microscopy techniques optimized for intracellular pathogens

    • Multi-color imaging to simultaneously track FtsK, other divisome components, and host factors

  • Quantitative analysis frameworks:

    • Mathematical modeling of FtsK dynamics during the developmental cycle

    • Correlative microscopy linking ultrastructure to protein localization

    • Single-cell analysis to capture heterogeneity in FtsK expression and function

  • Host interaction assessment:

    • Systems to evaluate how FtsK-dependent division rates affect inclusion development

    • Methods to determine if FtsK or division intermediates are recognized by host pattern recognition receptors

    • Approaches to assess if FtsK inhibition alters chlamydial persistence induction

Implementation of these improved models would enable researchers to better understand how FtsK function contributes to chlamydial pathogenesis, persistence, and interaction with host defense mechanisms, potentially revealing new therapeutic intervention points .

What comparative analyses of FtsK function across different Chlamydia species would be most informative for understanding its evolutionary adaptation?

Comparative analyses of FtsK across Chlamydia species would provide valuable insights into evolutionary adaptation of this critical division protein:

  • Structural and sequence comparisons:
    Detailed analysis of FtsK sequences across Chlamydia species (C. trachomatis, C. pneumoniae, C. psittaci, C. muridarum, etc.) would reveal:

    • Conserved domains essential for core functions

    • Variable regions that may relate to host/tissue specificity

    • Species-specific adaptations in the N-terminal, linker, and C-terminal domains

  • Localization pattern analysis:
    Comparing FtsK localization patterns across species would determine:

    • Whether the discrete focal pattern is conserved across the genus

    • If species with different cell morphologies show altered FtsK distribution

    • How FtsK localization relates to division mechanisms in different chlamydial species

  • Divisome component interaction studies:
    Cross-species analysis of FtsK interactions with other divisome components would:

    • Identify conserved protein-protein interactions

    • Reveal species-specific adaptations in divisome assembly

    • Help construct an evolutionary model of chlamydial division machinery

  • Functional complementation experiments:
    Testing whether FtsK from one Chlamydia species can complement deficiency in another would:

    • Determine functional conservation across species

    • Identify species-specific requirements

    • Provide insights into co-evolution with other divisome components

  • Correlation with ecological niches:
    Analyzing FtsK adaptations in relation to the distinct ecological niches of different Chlamydia species would:

    • Reveal how division mechanisms adapt to different host environments

    • Identify potential relationships between division efficiency and virulence

    • Provide context for understanding chlamydial speciation and host adaptation

This comparative approach would build a comprehensive evolutionary model of how FtsK function has been maintained and adapted across the Chlamydia genus, potentially revealing fundamental principles of bacterial division mechanism evolution in the absence of FtsZ .

What are common challenges in expressing and purifying functional recombinant Chlamydia trachomatis FtsK protein?

Researchers face several challenges when expressing and purifying functional recombinant Chlamydia trachomatis FtsK protein:

  • Membrane association issues:
    The N-terminal region of FtsK contains transmembrane domains that can cause aggregation during expression. Strategies to address this include:

    • Expression of truncated constructs lacking the transmembrane domains

    • Use of specialized detergents for membrane protein solubilization

    • Fusion with solubility-enhancing tags like MBP (maltose-binding protein)

  • Protein folding and stability:
    FtsK is a large protein (799 amino acids) with multiple domains that may fold incorrectly. Approaches to improve folding include:

    • Lowering expression temperature (16-18°C)

    • Co-expression with chaperones

    • Addition of stabilizing agents during purification

  • ATPase activity preservation:
    Maintaining the native ATPase activity is critical for functional studies. Considerations include:

    • Careful selection of buffer components

    • Addition of ADP or non-hydrolyzable ATP analogs during purification

    • Minimal exposure to freeze-thaw cycles

  • Expression system selection:
    While E. coli is commonly used, it may not produce optimally folded protein. Alternative systems include:

    • Cell-free expression systems

    • Insect cell expression for complex proteins

    • Specialized E. coli strains designed for membrane proteins

  • Purification strategy optimization:

    Purification ChallengeSolution Approach
    Low yieldOptimize codon usage for expression host
    Protein aggregationInclude detergents (DDM, CHAPS) throughout purification
    Co-purifying contaminantsSequential chromatography (IMAC, ion exchange, size exclusion)
    Loss of activity during concentrationUse glycerol and avoid high-pressure concentration methods
    Storage stabilityStore at -80°C with 15-20% glycerol in small aliquots

By addressing these challenges methodically, researchers can obtain functionally active recombinant FtsK protein suitable for biochemical, structural, and functional studies .

How can researchers validate that recombinant FtsK proteins maintain native functions in experimental settings?

Validating the native functionality of recombinant FtsK proteins requires a multi-faceted approach:

  • Biochemical activity assessment:

    • ATPase activity: Measure ATP hydrolysis rates using colorimetric assays or radioactive ATP

    • DNA binding: Assess sequence-specific and non-specific DNA binding using electrophoretic mobility shift assays

    • DNA translocation: Monitor DNA movement using single-molecule techniques like magnetic tweezers or FRET-based assays

  • Structural integrity validation:

    • Circular dichroism: Confirm proper secondary structure formation

    • Size exclusion chromatography: Verify proper oligomeric state

    • Limited proteolysis: Assess domain folding and accessibility

    • Thermal shift assays: Evaluate protein stability

  • Complementation testing:

    • In vivo functional assay: Transform the recombinant protein into CRISPRi-based FtsK knockdown Chlamydia to test for functional complementation

    • Localization patterns: Verify that fluorescently tagged recombinant FtsK localizes correctly

    • Developmental cycle effects: Assess if expression affects the chlamydial developmental cycle using inclusion forming unit (IFU) assays

  • Interaction validation:

    • Pull-down assays: Confirm interactions with known divisome partners

    • Surface plasmon resonance: Quantify binding affinities to interacting proteins

    • Microscopy co-localization: Verify co-localization with divisome components

  • Functional assays in reconstituted systems:

    • Liposome reconstitution: Test membrane association in artificial systems

    • In vitro divisome assembly: Assess ability to nucleate other divisome components in reconstituted systems

A comprehensive validation approach combining multiple methods provides confidence that the recombinant FtsK protein maintains its native functional properties and is suitable for further experimental studies .

What are the key considerations when designing experiments to study FtsK-dependent divisome assembly in Chlamydia trachomatis?

Designing robust experiments to study FtsK-dependent divisome assembly in Chlamydia trachomatis requires careful consideration of several factors:

  • Developmental cycle timing:

    • Synchronize infections to obtain populations at similar developmental stages

    • Target specific timepoints (typically 19-21 hours post-infection for reticulate bodies)

    • Consider how treatments affect developmental cycle progression

  • Knockdown/inhibition approaches:

    • Use inducible systems (like CRISPRi) with titratable induction levels

    • Apply inhibitors at different timepoints to distinguish assembly vs. maintenance roles

    • Include appropriate controls targeting other divisome components

  • Protein localization analysis:

    Technical ConsiderationRecommendation
    Sample preparationHarvest bacteria from infected cells rather than studying intact inclusions
    Fixation methodOptimize to preserve native structures (e.g., 4% PFA for 15 minutes)
    Antibody selectionValidate specificity with western blots and knockout controls
    Imaging parametersUse super-resolution techniques when possible
    Quantification approachScore at least 100 cells per condition with blinded analysis
  • Divisome component dependencies:

    • Establish clear assembly hierarchy through sequential knockdowns

    • Use double knockdown/inhibition to establish epistatic relationships

    • Apply temporal inhibition to distinguish assembly from maintenance requirements

  • Integration with peptidoglycan synthesis:

    • Use D-amino acid labeling to visualize nascent peptidoglycan

    • Correlate FtsK localization with sites of active peptidoglycan synthesis

    • Consider the impact of peptidoglycan synthesis inhibitors on FtsK localization

  • Controls and validations:

    • Include non-dividing populations as negative controls

    • Validate knockdown efficiency at both RNA and protein levels

    • Monitor potential off-target effects on other divisome components

  • Technological approaches:

    • Combine fluorescence microscopy with electron microscopy for ultrastructural context

    • Consider live-cell imaging when possible despite technical challenges

    • Implement quantitative image analysis for objective assessment

By addressing these considerations, researchers can design experiments that provide clear insights into the role of FtsK in chlamydial divisome assembly while minimizing technical artifacts and misinterpretations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.