Recombinant Chlamydia trachomatis Inclusion membrane protein A (incA)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Structure

IncA is a member of a protein family that Chlamydia synthesizes and secretes onto the inclusion membrane . While IncA proteins from different Chlamydia species exhibit limited sequence similarity, their biochemical properties are conserved . Both Chlamydia trachomatis and Chlamydia caviae IncA proteins self-associate to form multimers and localize to the endoplasmic reticulum when artificially expressed by the host cell .

The cytoplasmic domain of IncA has a unique non-canonical four-helix bundle structure . This structure features an intramolecular clamp crucial for IncA-mediated homotypic membrane fusion during infection .

Function in Inclusion Development

IncA is essential for the homotypic fusion of inclusions, a process where multiple inclusions within a host cell merge into a single, larger inclusion . This fusion enhances Chlamydia pathogenicity .

  • IncA can bind to itself and associate in trans when present on opposite membranes in a cell .

  • Ectopic expression of IncA on the endoplasmic reticulum (ER) membrane impacts inclusion integrity and ER morphology, suggesting that IncA on the ER interacts homotypically with IncA expressed on the inclusion and induces the fusion of both compartments .

  • A functional core of IncA, composed of SNARE-like domain 1 (SLD-1) and part of SNARE-like domain 2 (SLD-2), is required for the homotypic fusion of C. trachomatis inclusions in multiply infected cells .

Interaction with Host Cell Proteins

IncA interacts with host cell proteins, influencing host cell functions and contributing to the stability of the pathogen-containing vacuole .

  • IncA can interact with itself .

  • IncA interacts with MYPT1, a subunit of myosin phosphatase, as found in a yeast two-hybrid screen .

Role in Bacterial Exit

The Chlamydia trachomatis inclusion membrane protein CTL0390 plays a role in bacterial exit via lysis at late stages of the Chlamydia developmental cycle and through STING activation . Overexpression of CTL0390 at the inclusion membrane induces premature lysis and host nuclear condensation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
incA; CT_119; Inclusion membrane protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
incA
Target Protein Sequence
MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFLALLGHLVGFL IAPQITIVLLALFIISLAGNALYLQKTANLHLYQDLQREVGSLKEINFMLSVLQKEFLHL SKEFATTSKDLSAVSQDFYSCLQGFRDNYKGFESLLDEYKNSTEEMRKLFSQEIIADLKG SVASLREEIRFLTPLAEEVRRLAHNQQSLTVVIEELKTIRDSLRDEIGQLSQLSKTLTSQ IALQRKESSDLCSQIRETLSSPRKSASPSTKSS
Uniprot No.

Target Background

Function
Chlamydia replicate within an intracellular vacuole known as an inclusion. IncA is believed to be involved in the homotypic fusion of these inclusions.
Database Links

KEGG: ctr:CT_119

Subcellular Location
Secreted. Host vacuole, host pathogen-containing vacuole, host pathogen-containing vacuole membrane; Multi-pass membrane protein.

Q&A

What is Inclusion Membrane Protein A (IncA) in C. trachomatis?

IncA was the first member of the Inc family to be identified in Chlamydia trachomatis. It is a protein that localizes to the inclusion membrane during C. trachomatis infection of host cells. The protein plays a crucial role in the bacterial developmental cycle and has been extensively characterized in cell culture systems. IncA is not present in the elementary body (EB) stage of the chlamydial life cycle but is produced during the replicative stage when the bacteria are within host cells .

Structurally, recombinant IncA protein has been confirmed through mass spectrometry analysis, with Mascot scoring of 598 and matching of 7 peptides to the IncA sequence in the NCBI database . This protein is critical for inclusion membrane function and bacterial pathogenesis, making it an important target for research into C. trachomatis biology and potential therapeutic interventions.

How early in the C. trachomatis developmental cycle can IncA expression be detected?

IncA expression can be detected at a remarkably early stage of the C. trachomatis developmental cycle. While previous studies had reported IncA transcript detection at 10 hours post-infection with C. trachomatis serovar L2 strain and 16 hours post-infection with the C. trachomatis serovar D strain, more recent studies indicate that both IncA transcription and protein expression can be detected as early as 4 hours after infection .

RNA transcripts of IncA were detected as early as 4 hours and persisted up to 30 hours post-infection, as demonstrated by RT-PCR analysis . This early expression suggests that IncA may be classified as an early expression protein that could potentially serve as a candidate in early detection applications for C. trachomatis infections. The detection methodology typically involves:

  • Harvesting infected cells at various time points post-infection

  • Isolating RNA for RT-PCR analysis or protein for Western blotting

  • Using IncA-specific primers (for RNA) or antibodies (for protein)

  • Documenting the temporal expression pattern throughout the developmental cycle

This early expression pattern distinguishes IncA from many other chlamydial proteins and highlights its potential importance in the initial establishment of infection.

Where is IncA localized within infected cells?

IncA is primarily localized in the inclusion membranes of C. trachomatis and in fibers extending into the host cytosol . The inclusion is a parasitophorous vacuole in which C. trachomatis resides and replicates within the host cell. IncA's strategic position at the inclusion membrane allows it to interact with both bacterial and host cellular components.

This localization is critical for its function in homotypic fusion of inclusions, which occurs when multiple C. trachomatis elementary bodies infect a single cell . When IncA is knocked down, as demonstrated in experiments using sRNA-mediated conditional knockdown systems, there is a loss of IncA staining at the inclusion membrane, resulting in the production of multiple chlamydial inclusions within an infected cell rather than a single fused inclusion .

The specific localization pattern can be visualized through:

  • Immunofluorescence microscopy using anti-IncA antibodies

  • Confocal microscopy for detailed 3D visualization

  • Western blotting of membrane fractions to confirm membrane association

This specific membrane localization is essential for understanding IncA's functional role in C. trachomatis infection and pathogenesis.

What is the functional significance of IncA in C. trachomatis infections?

IncA plays several crucial roles in C. trachomatis infection, with its primary function being the mediation of homotypic fusion of inclusions . When multiple elementary bodies infect a single host cell, they initially reside in separate inclusions. IncA facilitates the fusion of these separate inclusions into a single large inclusion, which is important for the pathogen's survival and replication strategy.

The functional significance of IncA has been experimentally demonstrated through knockdown studies. When IncA is functionally knocked down using methods such as sRNA-mediated conditional knockdown, multiple chlamydial inclusions form within an infected cell instead of a single fused inclusion . This phenotype directly confirms IncA's necessary role in the fusion process.

Additionally, IncA has significant immunogenic properties. The protein elicits antibody responses in infected individuals, with antibodies to IncA detected in urine and genital swab specimens from C. trachomatis-infected patients . Specifically:

  • 52.1% (24 of 46) of urine samples exhibited antibody response to IncA

  • 71.4% (40 of 56) of genital swab samples showed antibody response to IncA

This immunogenicity suggests that IncA could potentially be utilized as a diagnostic marker or as a vaccine candidate against C. trachomatis infections .

How does IncA contribute to the pathogenesis of C. trachomatis?

IncA contributes to C. trachomatis pathogenesis through several sophisticated mechanisms. As a key mediator of inclusion fusion, IncA allows multiple separate inclusions to fuse into a single inclusion within an infected cell . This fusion is believed to enhance bacterial survival and replication by creating a more favorable microenvironment for the pathogen.

The protein's strategic localization at the inclusion membrane positions it as an interface between the pathogen and the host cell, potentially allowing it to modulate host cellular responses to infection. This interaction may influence the host immune response and contribute to the pathogen's ability to establish a persistent infection .

Furthermore, the early expression of IncA (as early as 4 hours post-infection) suggests it plays an important role in the early stages of infection establishment . The immunogenic nature of IncA, evidenced by the detection of IncA antibodies in clinical specimens, indicates that it is recognized by the host immune system during infection . This immune recognition could either contribute to protective immunity or potentially to immunopathology, depending on the specific host-pathogen interactions.

Research examining IncA's pathogenic role should incorporate:

  • Analysis of host-protein interactions at the inclusion membrane

  • Comparison of wild-type and IncA-deficient strain pathogenicity

  • Evaluation of immune response modulation by IncA

  • Assessment of IncA's impact on bacterial replication efficiency and persistence

Understanding the full range of IncA's contributions to pathogenesis requires further investigation into its interactions with host cellular components and its role in the chlamydial developmental cycle.

What role does IncA play in the homotypic fusion of inclusion?

IncA plays a critical and well-documented role in the homotypic fusion of chlamydial inclusions within infected host cells. When multiple C. trachomatis elementary bodies infect a single cell, they initially develop in separate inclusions. IncA facilitates the fusion of these separate inclusions into a single large inclusion .

The importance of IncA in this fusion process has been definitively demonstrated through functional knockdown experiments. When IncA is depleted using an sRNA-mediated conditional knockdown system, infected cells exhibit multiple chlamydial inclusions rather than a single fused inclusion . This phenotype directly confirms IncA's essential role in the fusion process.

At the molecular level, IncA localizes to the inclusion membrane and extends fibers into the host cytosol . These extensions may facilitate interactions between separate inclusions, promoting their fusion. The fusion process is believed to be advantageous for the pathogen, potentially allowing for:

  • More efficient nutrient acquisition

  • Protection from host defense mechanisms

  • Coordination of the developmental cycle across the bacterial population

  • Optimization of the inclusion microenvironment

The fusion-mediating property of IncA makes it an important target for potential therapeutic interventions, as disrupting inclusion fusion could potentially attenuate C. trachomatis infection and pathogenesis.

How can functional studies of IncA inform vaccine development strategies?

While the search results don't directly address vaccine development, the immunological data on IncA provides a methodological framework for vaccine research. The documented antibody responses to IncA in clinical specimens from infected individuals suggest potential for vaccine applications .

A methodological approach to exploring IncA's vaccine potential would include:

  • Epitope Mapping:

    • Identify immunodominant regions of IncA that consistently elicit antibody responses

    • Determine if these regions are conserved across C. trachomatis serotypes

    • Map epitopes that correlate with protective immunity versus those associated with pathology

  • Animal Model Studies:

    • Immunize animal models with recombinant IncA or IncA-derived peptides

    • Challenge with C. trachomatis infection to assess protection

    • Compare protection levels with different immunization strategies (protein subunit, DNA vaccines, etc.)

  • Correlates of Protection:

    • Analyze if anti-IncA antibody levels correlate with protection against infection

    • Determine if antibodies that block IncA-mediated inclusion fusion can prevent effective infection

    • Evaluate both humoral and cell-mediated immune responses to IncA

  • Cross-Protection Assessment:

    • Test if IncA-induced immunity provides protection against multiple C. trachomatis serovars

    • Evaluate if IncA conservation (reported in search results) translates to broad protection

  • Combination Strategies:

    • Assess IncA as part of multi-component vaccine strategies

    • Determine synergistic effects when combined with other chlamydial antigens

The research data showing that IncA is conserved across different C. trachomatis serotypes sequenced so far suggests that IncA-specific immune responses might recognize IncA from all serotypes equally well . This conservation makes IncA a potentially attractive vaccine candidate for providing broad protection against multiple C. trachomatis strains.

Can IncA serve as a diagnostic marker for C. trachomatis infections?

IncA shows significant potential as a diagnostic marker for C. trachomatis infections based on several key findings. Research indicates that IncA antibody responses can be detected in a substantial percentage of clinical specimens from infected individuals:

Specimen TypePositive for IncA AntibodyPercentage
Urine24 of 4652.1%
Genital Swab40 of 5671.4%

Additionally, IncA antigen was detected in 21.3% of urine specimens from infected patients .

These findings are particularly noteworthy because they demonstrate that IncA-specific immune responses can be detected not only in serum (as previously reported) but also in urine and genital swab specimens, which are more accessible and less invasive to collect . This expands the potential utility of IncA as a diagnostic marker.

Furthermore, IncA's early expression during the C. trachomatis developmental cycle (as early as 4 hours post-infection) suggests it could potentially serve as an early marker of infection . The protein is also conserved across different C. trachomatis serotypes, suggesting broad applicability across different strains .

How can recombinant IncA protein be expressed and purified?

While the search results don't provide a detailed protocol for expressing and purifying recombinant IncA protein, they confirm that recombinant IncA was successfully produced and verified by mass spectrometry analysis . Based on this information and standard molecular biology techniques, here is a methodological approach for expressing and purifying recombinant IncA:

  • Gene Cloning:

    • Obtain the IncA gene sequence from C. trachomatis genomic DNA

    • Design primers with appropriate restriction sites for subsequent cloning

    • Amplify the IncA gene using PCR

    • Clone into an expression vector (typically with a histidine tag for purification)

  • Expression System Selection:

    • Choose an appropriate bacterial expression system (typically E. coli BL21(DE3))

    • Transform the recombinant plasmid into the expression host

    • Optimize expression conditions (temperature, IPTG concentration, induction time)

  • Protein Expression:

    • Grow transformed bacteria to mid-log phase

    • Induce protein expression with IPTG or other appropriate inducer

    • Harvest cells after optimal induction period

  • Cell Lysis and Initial Purification:

    • Resuspend bacterial pellet in appropriate lysis buffer with protease inhibitors

    • Lyse cells using sonication or mechanical disruption

    • Clarify lysate by centrifugation to remove cellular debris

  • Affinity Purification:

    • Apply clarified lysate to Ni-NTA or other affinity resin

    • Wash extensively to remove non-specifically bound proteins

    • Elute recombinant IncA using imidazole gradient or other appropriate method

  • Protein Verification:

    • Analyze by SDS-PAGE to confirm purity and expected molecular weight

    • Perform Western blot analysis with anti-His tag and/or anti-IncA antibodies

    • Conduct mass spectrometry analysis to confirm protein identity

      • As noted in the research, Mascot analysis should show a high score (598 in the referenced study)

      • Multiple peptides should match to the IncA sequence in the NCBI database

  • Secondary Purification (if needed):

    • Perform size exclusion chromatography to remove aggregates and improve purity

    • Consider ion exchange chromatography based on IncA's theoretical isoelectric point

  • Quality Control:

    • Assess protein folding using circular dichroism or other structural techniques

    • Verify biological activity through functional assays

    • Check endotoxin levels if the protein will be used in immunological studies

This methodological approach provides a framework for producing high-quality recombinant IncA protein for various research applications, including antibody production, structural studies, and immunological assays.

What methods can be used to detect IncA antibodies in clinical specimens?

Based on the search results, immunoblotting (Western blotting) was successfully employed to detect IncA antibodies in clinical specimens from C. trachomatis-infected patients . Here is a detailed methodological approach for detecting IncA antibodies in clinical specimens:

  • Specimen Collection and Processing:

    • Collect appropriate clinical specimens (urine or genital swabs)

    • Process specimens according to standardized protocols

    • For urine: centrifuge to remove cellular debris, possibly concentrate proteins

    • For genital swabs: elute in appropriate buffer, process to extract antibodies

  • Western Blotting (Immunoblotting):

    • Prepare purified recombinant IncA protein

    • Separate by SDS-PAGE and transfer to nitrocellulose or PVDF membrane

    • Block membrane with appropriate blocking solution (typically 5% milk or BSA)

    • Incubate with processed clinical specimen (diluted appropriately)

    • Wash to remove unbound antibodies

    • Incubate with secondary antibody (anti-human IgG/IgA conjugated to HRP or other detectable label)

    • Develop using appropriate detection system

    • A positive result is indicated by a band at the molecular weight of IncA

  • Essential Controls:

    • Positive controls: Include anti-IncA antibody and anti-His antibody (if using His-tagged recombinant IncA)

    • Negative controls: Include specimens from healthy individuals without C. trachomatis infection

    • As shown in Figure 2 of the referenced study, IncA antibody was present in most specimens from infected patients but absent in controls

  • ELISA Method (Alternative Approach):

    • Coat microplate wells with purified recombinant IncA

    • Block non-specific binding sites

    • Add processed clinical specimens

    • Wash and add enzyme-conjugated secondary antibody

    • Add substrate and measure optical density

    • Compare to established cutoff values for positive/negative determination

  • Data Analysis:

    • Calculate positivity rates across different specimen types

    • The referenced study found 52.1% positivity in urine and 71.4% in genital swabs

    • Compare results with other diagnostic methods for validation

  • Considerations for Optimization:

    • Determine optimal dilution of clinical specimens

    • Establish appropriate cutoff values for distinguishing positive from negative results

    • Consider preabsorption of specimens to reduce non-specific binding

    • Evaluate the impact of specimen storage conditions on antibody detection

These methodological approaches provide a framework for reliably detecting IncA-specific antibodies in various clinical specimens, which can be valuable for both research and potential diagnostic applications.

How can small RNA (sRNA) be used for functional knockdown of IncA?

Based on search result , a novel sRNA-mediated conditional knockdown system has been developed for C. trachomatis proteins, including IncA. This approach represents a significant advancement in chlamydial genetics. Here is a detailed methodological approach:

  • Design of sRNA Constructs:

    • Engineer a small RNA specifically designed to target the mRNA of IncA

    • The sRNA inhibits translation by binding to the target gene's mRNA

    • Design must ensure specificity to avoid off-target effects

  • Expression System Development:

    • Create a vector system for conditional expression of the sRNA in C. trachomatis

    • Include appropriate promoters for controlled induction

    • Incorporate selection markers for identifying transformed bacteria

  • Transformation into C. trachomatis:

    • Introduce the engineered sRNA construct into C. trachomatis

    • Select for transformants using appropriate antibiotics

    • Verify successful transformation by PCR or other methods

  • Induction of Knockdown:

    • Activate sRNA expression using the appropriate inducer

    • The system allows for titratable control, meaning the degree of knockdown can be adjusted by varying inducer concentration

    • The effect is reversible when the inducer is removed

  • Verification of Knockdown:

    • Confirm reduction of IncA protein levels via Western blotting

    • Verify loss of IncA staining at the inclusion membrane using immunofluorescence microscopy

    • Quantify the degree of knockdown to establish dose-response relationship

  • Phenotypic Analysis:

    • Observe the formation of multiple inclusions within infected cells (the hallmark phenotype of IncA depletion)

    • Document the number and size of inclusions per infected cell

    • Compare with control (non-induced) conditions

  • Specificity Controls:

    • Target other inclusion membrane proteins (like IncE and IncG) to demonstrate specificity

    • Results should show protein-specific effects without altering levels of non-targeted proteins

    • For example, IncE knockdown reduced IncE levels without affecting IncG, and vice versa

  • Functional Studies:

    • Assess impact on bacterial development and replication

    • Evaluate effects on host-pathogen interactions

    • Study the consequences for infection progression

This sRNA-mediated conditional knockdown system provides several advantages over traditional genetic approaches:

  • It allows study of potentially essential genes (like MOMP mentioned in the search results)

  • It enables targeting of individual genes within operons without polar effects

  • The titratable and reversible nature permits more nuanced functional studies

  • It can be applied to study various aspects of C. trachomatis biology beyond IncA

This methodology represents a powerful approach for dissecting the functions of IncA and other C. trachomatis proteins in the context of infection.

What techniques are available to visualize IncA in infected cells?

Based on the search results and standard techniques in cell biology, several sophisticated methods can be employed to visualize IncA in C. trachomatis-infected cells:

  • Immunofluorescence Microscopy:

    • Fix infected cells at various time points post-infection

    • Permeabilize cells to allow antibody access to the inclusion membrane

    • Incubate with anti-IncA antibodies (such as anti-C. trachomatis IncA polyclonal antiserum)

    • Apply fluorescently labeled secondary antibodies

    • Counterstain DNA (bacterial and host) with DAPI or similar dye

    • Visualize using fluorescence microscopy to observe:

      • IncA localization at the inclusion membrane

      • Fibers extending into the host cytosol

      • Loss of IncA staining in knockdown experiments

  • Western Blotting for Temporal Analysis:

    • Harvest infected cells at defined intervals post-infection

    • Prepare protein lysates and separate by SDS-PAGE

    • Transfer to membrane and probe with anti-IncA antibodies

    • This technique was specifically used in the search results to analyze IncA expression in C. trachomatis-infected HeLa cells at various time points

    • The Western blot results can document the time course of IncA expression from 4 hours through 30 hours post-infection

  • Confocal Microscopy:

    • Use confocal microscopy for detailed 3D visualization

    • Generate z-stack images to examine IncA distribution throughout the inclusion

    • Perform co-localization studies with other bacterial or host proteins

    • This approach provides superior resolution of spatial relationships between IncA and other cellular components

  • Super-Resolution Microscopy:

    • Apply techniques like STORM, PALM, or STED for nanoscale resolution

    • Examine detailed organization of IncA at the inclusion membrane

    • Visualize protein clustering and microdomain formation

    • These techniques can reveal structural details beyond the diffraction limit of conventional light microscopy

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence microscopy with electron microscopy

    • Precisely localize IncA at the ultrastructural level

    • Examine the relationship between IncA and membrane microdomains

  • Live-Cell Imaging (for engineered systems):

    • Create fluorescently tagged versions of IncA

    • Monitor dynamics of IncA localization in real-time

    • Observe inclusion fusion events and IncA redistribution

    • Study protein trafficking and temporal dynamics

Each visualization technique offers distinct advantages and can be selected based on the specific research question being addressed. The combination of multiple imaging modalities provides complementary information about IncA localization, expression patterns, and functional interactions during C. trachomatis infection.

How should antibody responses to IncA in different clinical specimens be compared?

Based on the search results and standard immunological approaches, here is a comprehensive methodological framework for comparing antibody responses to IncA across different clinical specimen types:

  • Standardization of Detection Protocols:

    • Implement consistent specimen collection and processing methods

    • Use identical immunoblotting or ELISA protocols across all specimen types

    • Maintain the same positive and negative controls in all assays

    • Process all specimens in parallel when possible to minimize inter-assay variation

  • Quantitative Assessment Approaches:

    • For immunoblotting:

      • Use densitometry to quantify band intensities

      • Apply background subtraction and normalization

      • Establish standard curves with known antibody concentrations

    • For ELISA:

      • Record raw optical density (OD) values

      • Apply appropriate curve-fitting models

      • Calculate relative or absolute antibody concentrations

  • Statistical Analysis Framework:

    • Calculate positivity rates with confidence intervals:

      • Urine: 52.1% (24/46) positive for IncA antibodies

      • Genital swabs: 71.4% (40/56) positive for IncA antibodies

    • Apply chi-square tests to determine if differences between specimen types are statistically significant

    • For quantitative data, employ paired t-tests (for matched specimens) or ANOVA

  • Cross-Specimen Correlation Analysis:

    • For patients providing multiple specimen types, calculate correlation coefficients

    • Determine if antibody levels in different specimens from the same individual correlate

    • Assess concordance/discordance patterns

  • Accounting for Specimen-Specific Variables:

    • Urine: Consider concentration/dilution effects, pH, and protein content

    • Genital swabs: Account for sampling variation and local antibody production

    • Establish specimen-specific baselines and cutoff values

  • Comparative Data Presentation:

    • Create comparative tables showing positivity rates across specimen types

    • Develop scatter plots with paired samples to visualize correlations

    • Use box plots to display distribution of antibody levels by specimen type

  • Multivariate Analysis:

    • Incorporate clinical variables (infection duration, symptoms, co-infections)

    • Perform multiple regression to identify factors influencing antibody detection

    • Develop predictive models for antibody response patterns

  • Integration with Antigen Detection Data:

    • Compare antibody detection rates with antigen detection rates (21.3% in urine specimens)

    • Analyze temporal relationships between antigen and antibody positivity

    • Calculate sensitivity and specificity of combined testing approaches

This methodological framework enables rigorous comparison of IncA antibody responses across different clinical specimens, providing insights into the dynamics of the immune response to C. trachomatis infection and informing the development of diagnostic strategies.

What considerations are important when analyzing IncA knockout phenotypes?

Based on the search results, particularly the information about the sRNA-mediated conditional knockdown of IncA , here are critical methodological considerations when analyzing IncA knockout or knockdown phenotypes:

  • Verification of Knockdown Efficiency:

    • Quantitatively assess IncA protein reduction via Western blotting

    • Determine the spatial pattern of loss using immunofluorescence microscopy

    • Establish a dose-response relationship between inducer concentration and knockdown level

    • Document the temporal dynamics of protein depletion after induction

  • Phenotypic Characterization and Quantification:

    • Primary phenotype: Formation of multiple inclusions within infected cells

    • Quantitative metrics to assess:

      • Average number of inclusions per infected cell

      • Size distribution of inclusions

      • Spatial distribution of inclusions within the cell

      • Percentage of cells showing the multiple inclusion phenotype

    • Apply automated image analysis for unbiased quantification

  • Temporal Analysis Framework:

    • Examine phenotype development across the infection cycle

    • Determine critical time windows when IncA function is most essential

    • Assess whether phenotypes are stage-specific or persistent

  • Reversibility Assessment Protocol:

    • Utilize the reversible nature of the sRNA system :

      • Induce knockdown, then remove inducer

      • Document the timeline of protein reexpression

      • Determine if phenotypes revert to wild-type after protein restoration

      • Assess whether there is a "point of no return" after which phenotypes become irreversible

  • Titration Effect Analysis:

    • Exploit the titratable nature of the sRNA system

    • Create a series of partial knockdown conditions

    • Determine if there is a threshold level of IncA required for normal function

    • Assess whether different IncA functions have different protein level requirements

  • Specificity Controls:

    • Critical control experiments demonstrated in the research:

      • IncE knockdown affected only IncE (not IncG) and its binding partner SNX6

      • IncG knockdown reduced only IncG (not IncE) and prevented 14-3-3β recruitment

    • These controls confirm the specificity of the knockdown approach

    • Similar controls should be implemented for IncA studies

  • Functional Consequence Assessment:

    • Bacterial development metrics:

      • Inclusion formation and growth rate

      • Bacterial replication efficiency

      • Elementary body production

      • Infectivity of progeny

    • Host-pathogen interaction analysis:

      • Recruitment of host proteins to the inclusion

      • Changes in host cell signaling

      • Alterations in immune recognition

  • Comparative Analysis Framework:

    • Compare sRNA knockdown phenotypes with:

      • Natural IncA-deficient strains (if available)

      • Chemical inhibition of IncA function

      • Host cell manipulation affecting IncA function

This systematic methodological approach ensures robust analysis of IncA knockdown phenotypes, providing reliable insights into IncA function in C. trachomatis biology and pathogenesis.

How can temporal expression patterns of IncA be accurately quantified?

Based on the search results and standard molecular biology practices, here is a methodological approach for quantifying temporal expression patterns of IncA:

  • RNA-level Quantification (Transcriptional Analysis):

    • RT-PCR/qRT-PCR Protocol:

      • Harvest infected cells at defined intervals (4-30 hours post-infection)

      • Extract total RNA using methods that preserve RNA integrity

      • Perform DNase treatment to remove contaminating DNA

      • Synthesize cDNA using oligo(dT) or random hexamer primers

      • Quantify IncA transcript levels using real-time PCR with specific primers

      • Normalize to appropriate reference genes stable during chlamydial infection

      • Calculate relative expression using 2^(-ΔΔCt) or similar method

      • Generate time-course expression profiles

  • Protein-level Quantification (Translational Analysis):

    • Western Blotting Time-course Analysis:

      • Collect infected cells at multiple time points post-infection

      • Prepare protein extracts under standardized conditions

      • Separate proteins by SDS-PAGE and transfer to membranes

      • Probe with anti-IncA antibodies and loading control antibodies

      • As shown in the search results, IncA protein can be detected from 4 hours post-infection

      • Perform densitometric analysis of band intensities

      • Normalize to appropriate loading controls

      • Plot normalized intensity versus time to visualize expression kinetics

  • Quantitative Microscopy Approaches:

    • Time-course Immunofluorescence Analysis:

      • Fix infected cells at defined intervals post-infection

      • Stain with anti-IncA antibodies and appropriate counterstains

      • Capture images using consistent microscope settings

      • Measure fluorescence intensity at the inclusion membrane

      • Normalize to inclusion size or bacterial markers

      • Track changes in localization pattern over time

      • Document the progression from early punctate staining to continuous membrane distribution

  • Integrated Multi-parameter Analysis:

    • Correlation between RNA and Protein Levels:

      Time Post-infectionRNA DetectionProtein DetectionLocalization Pattern
      4 hoursDetectableDetectableEarly localization
      8-10 hoursIncreasingIncreasingInclusion membrane
      24-30 hoursPersistentAbundantComplete membrane
  • Mathematical Modeling of Expression Dynamics:

    • Apply kinetic models to quantify:

      • Rate of IncA transcription initiation

      • mRNA stability and half-life

      • Translation efficiency

      • Protein turnover rate

    • Develop predictive models of IncA accumulation during the developmental cycle

  • Single-cell Analysis Techniques:

    • Account for cell-to-cell variation in infection progression

    • Quantify heterogeneity in IncA expression within a population

    • Correlate IncA expression with inclusion development stage

    • Identify potential subpopulations with distinct expression patterns

  • Validation and Quality Control:

    • Perform biological and technical replicates

    • Calculate statistical measures of variation

    • Compare results across different quantification methods

    • Establish standard curves with recombinant IncA for absolute quantification

These methodological approaches provide a comprehensive framework for accurately quantifying and characterizing the temporal expression patterns of IncA throughout the C. trachomatis developmental cycle, from the early expression at 4 hours post-infection through the late stages at 30 hours post-infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.