Recombinant Chlamydia trachomatis Inclusion membrane protein G (incG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
incG
Target Protein Sequence
MICCDKVLSSVQSMPVIDKCSVTKCLQTAKQAAVLALSLFAVFASGSLSILSAAVLFSGT AAVLPYLLILTTALLGFVCAVIVLLRNLSAVVQSCKKRSPEEIEGAARPSDQQESGGRLS EESASPQASPTSSTFGLESALRSIGDSVSGAFDDINKDNSRSRSHSF
Uniprot No.

Q&A

What is Chlamydia trachomatis Inclusion membrane protein G (IncG)?

IncG is one of approximately 50 inclusion membrane proteins encoded by the C. trachomatis genome that localizes to the inclusion membrane during infection. It belongs to a family of proteins characterized by at least one bilobed hydrophobic motif mediating insertion into the membrane of the inclusion . The inclusion is a pathogen-modified vacuole where Chlamydia replicates intracellularly, protected from host defense mechanisms. IncG is expressed early in infection (within the first 2 hours after internalization) and plays a role in host-pathogen interactions by interacting with host cell proteins .

How is the localization of IncG experimentally confirmed?

The localization of IncG to the inclusion membrane has been experimentally verified using several complementary techniques:

  • Antibody-based detection: Using antibodies raised against GST-fusion proteins to detect endogenous IncG in C. trachomatis-infected cells via immunofluorescence microscopy .

  • Fusion protein analysis: Expression of tagged versions of IncG (such as GFP-tagged or FLAG-tagged constructs) and observation of their localization in infected cells .

  • Phosphorylation assays: Immunoprecipitation studies with [32P]-orthophosphate-labeled cells have demonstrated that IncG is phosphorylated in both chlamydia-infected host cells and in yeast cells expressing IncG, which is consistent with its localization in the inclusion membrane with access to host kinases .

What is the structural organization of IncG?

IncG, like other Inc proteins, contains:

  • A characteristic bilobed hydrophobic domain that mediates its insertion into the inclusion membrane.

  • Cytoplasmic domains that are exposed to the host cell cytosol and can interact with host proteins.

  • Phosphorylation sites, particularly a conserved 14-3-3-binding motif (RS164RS166F) that is critical for interaction with host 14-3-3β protein .

While the exact three-dimensional structure remains to be determined, studies have shown that both the amino and carboxy-terminal regions of Inc proteins can be exposed to the host cell cytoplasm, flanking the central hydrophobic domains that anchor the protein in the inclusion membrane .

How does IncG interact with host cell proteins?

IncG specifically interacts with the host protein 14-3-3β, a phosphoserine-binding protein involved in various signaling pathways. This interaction has been confirmed through multiple methods:

  • Yeast two-hybrid screening: Initially identified 14-3-3β as an IncG-interacting partner .

  • Co-localization in infected cells: Indirect immunofluorescence microscopy shows co-localization of 14-3-3β with IncG at the inclusion membrane .

  • Interaction with GFP-14-3-3β fusion protein: Fluorescently tagged 14-3-3β localizes to inclusions containing IncG .

  • Site-directed mutagenesis: Mutations in the predicted 14-3-3β phosphorylation sites demonstrated that IncG binds to 14-3-3β via a conserved binding motif (RS164RS166F) .

The interaction is species-specific, as 14-3-3β associates with C. trachomatis inclusions but not with C. psittaci or C. pneumoniae inclusions .

What is the functional significance of the IncG-14-3-3β interaction?

The IncG-14-3-3β interaction is proposed to have several functions in C. trachomatis pathogenesis:

  • Sequestration of pro-apoptotic proteins: The interaction may sequester the pro-apoptotic protein BAD, protecting the infected cell from programmed cell death and allowing the completion of the bacterial developmental cycle .

  • Modification of host signaling pathways: 14-3-3β is a component of various signaling pathways, and its recruitment to the inclusion may alter host cell responses to infection .

  • Species-specific pathogenesis: The specificity of this interaction to C. trachomatis (and not C. psittaci or C. pneumoniae) suggests it may contribute to the unique pathogenesis of C. trachomatis infections .

What techniques are used to produce and study recombinant IncG?

Several methodologies have been employed to produce and analyze recombinant IncG:

  • Bacterial expression systems: Production of GST-fusion proteins in E. coli for raising antibodies and for in vitro binding studies .

  • Mammalian expression vectors: For ectopic expression of IncG in eukaryotic cells to study its effects and interactions .

  • Yeast two-hybrid systems: To identify host protein interactions, as used to discover the IncG-14-3-3β interaction .

  • Bacterial two-hybrid analysis (BACTH): While not specifically mentioned for IncG in the search results, this system has been successfully used to study interactions between other Inc proteins and could be applied to IncG .

  • Phosphorylation assays: Using [32P]-orthophosphate labeling to detect phosphorylation of IncG in infected cells or heterologous expression systems .

How can researchers design experiments to study IncG function?

Experimental ApproachMethodologyExpected OutcomesTechnical Considerations
Site-directed mutagenesisCreate point mutations in key domains of IncG (e.g., phosphorylation sites)Identify critical residues for protein-protein interactionsRequires knowledge of key motifs; confirm expression levels
Conditional expressionUse inducible promoters to control IncG expression timingDetermine when IncG function is critical during infectionSimilar to approaches used for other Incs like IncS
CRISPR-Cas9 gene editingTargeted disruption of IncG in C. trachomatisAnalyze phenotypic effects of IncG absenceChallenging in Chlamydia due to obligate intracellular lifestyle
Fluorescence microscopyTag IncG with fluorescent proteinsVisualize dynamics of IncG localization during infectionEnsure tags don't interfere with protein function
Phosphoproteomic analysisMass spectrometry of immunoprecipitated IncGIdentify phosphorylation sites and modificationsRequires sufficient protein quantities and enrichment

How can researchers analyze the immunogenicity of IncG?

Studies have shown that Inc proteins, including IncG, can be immunogenic during C. trachomatis infection. To analyze this immunogenicity:

  • Serum antibody screening: Test sera from individuals with confirmed C. trachomatis infections against recombinant IncG to detect specific antibodies .

  • Epitope mapping: Determine which regions of IncG are most immunogenic using truncated protein constructs. Research has shown that antibodies from women with C. trachomatis infections preferentially recognize the C-terminal regions of Inc proteins that are exposed to the host cell cytoplasm .

  • T-cell response analysis: Evaluate CD4+ and CD8+ T-cell responses to IncG peptides, similar to studies done with other Inc proteins like CrpA (CT442) .

  • Vaccine candidate assessment: Evaluate the protective potential of IncG immunization against subsequent C. trachomatis challenge in animal models, as has been demonstrated with CrpA .

How does IncG compare functionally to other well-characterized Inc proteins?

Inc ProteinKey InteractionsProposed FunctionsSpecies Specificity
IncG (focus)14-3-3βAnti-apoptotic; signaling modulationC. trachomatis only
IncASNAREs; self-oligomerizationInclusion fusion; membrane dynamicsMultiple Chlamydia species
CT006Associates with lipid dropletsPotentially involved in lipid acquisitionC. trachomatis
CT229/CpoSRab GTPasesInhibits host cell deathC. trachomatis
IncDCERT (Ceramide Transport) proteinsLipid transport/metabolismC. trachomatis
CT442/CrpACD8+ T cell recognitionImmunogenic; potential vaccine candidateC. trachomatis

This comparison demonstrates the diverse functions of Inc proteins in modifying host-pathogen interactions, with IncG specifically involved in host signaling modulation through 14-3-3β binding .

What are the challenges in studying Inc protein interactions and complexes?

Several challenges exist in studying Inc protein interactions:

  • Membrane protein complexity: The bilobed hydrophobic domains that mediate membrane insertion can complicate expression and purification of recombinant proteins .

  • Heterologous expression systems: The bacterial and eukaryotic membrane environments differ, potentially affecting protein folding and interactions when expressed in E. coli or yeast .

  • Oligomerization properties: Many Inc proteins, like IncA, can oligomerize, which may influence their interactions with other proteins .

  • Transient or weak interactions: Some Inc-host protein interactions may be transient or dependent on specific conditions (e.g., phosphorylation status) .

  • Functional redundancy: Multiple Inc proteins may have overlapping functions, complicating single-gene knockout studies .

What is the optimal protocol for expressing recombinant IncG?

While specific protocols for IncG were not detailed in the search results, based on approaches used for other Inc proteins:

  • Expression vector selection: For bacterial expression, pGEX vectors have been successfully used to generate GST-fusion proteins. For mammalian expression, vectors with strong promoters like CMV are recommended .

  • Expression conditions optimization:

    • For bacterial expression: Induce at OD600 of 0.6-0.8, with IPTG concentrations of 0.1-1.0 mM.

    • For expression in eukaryotic cells: Transfection efficiency should be optimized for the specific cell type.

  • Solubilization and purification considerations: Due to the hydrophobic domains, inclusion of detergents (such as Triton X-100 or n-dodecyl-β-D-maltoside) may be necessary to maintain solubility during purification .

  • Tag selection: N-terminal tags are generally preferable as they are less likely to interfere with the C-terminal domain that interacts with host proteins .

How can researchers verify the functional activity of recombinant IncG?

To ensure that recombinant IncG is functionally active:

  • Binding assays: Confirm binding to 14-3-3β using pull-down assays, surface plasmon resonance, or other protein interaction techniques .

  • Phosphorylation status: Verify that the recombinant protein can be phosphorylated by appropriate kinases, as phosphorylation is critical for 14-3-3β binding .

  • Cellular localization: When expressed in eukaryotic cells, functionally active IncG should associate with cellular membranes in patterns consistent with its natural localization .

  • Competition assays: Recombinant IncG should be able to compete with endogenous IncG for 14-3-3β binding in infected cells .

How can recombinant IncG be used in vaccine development strategies?

Based on research with other Inc proteins like CrpA (CT442), recombinant IncG could be explored for vaccine development:

  • Immunogenicity assessment: Determine if recombinant IncG can elicit strong antibody and T-cell responses in animal models .

  • Protective immunity evaluation: Test if immunization with recombinant IncG provides protection against subsequent C. trachomatis challenge .

  • Epitope identification: Map specific regions of IncG that generate protective immune responses to develop epitope-based vaccines .

  • Combination approaches: Evaluate IncG in combination with other C. trachomatis antigens, such as MOMP (Major Outer Membrane Protein), to potentially enhance protective immunity .

What are promising areas for future research on IncG?

Several promising research directions emerge from the current understanding of IncG:

  • Structural studies: Determine the three-dimensional structure of IncG, particularly in complex with 14-3-3β, to understand the molecular basis of this interaction.

  • Systems biology approaches: Integrate IncG into the broader network of host-pathogen interactions during C. trachomatis infection.

  • Therapeutic targeting: Explore whether disrupting the IncG-14-3-3β interaction could serve as a novel therapeutic approach for C. trachomatis infections.

  • Cross-species comparative analysis: Further investigate why the IncG-14-3-3β interaction is specific to C. trachomatis and how this contributes to species-specific pathogenesis .

  • Genetic manipulation studies: Develop conditional mutants of IncG in C. trachomatis, similar to approaches used for other Inc proteins like IncS , to precisely define its role in different stages of the developmental cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.