Recombinant Chlamydia trachomatis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; CT_408; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
lspA
Target Protein Sequence
MPTRSLPTFLTLLLLASIDWVSKLVVLLKSCQLSPHSSAFLYSYVWGHFSFLIIPSFNEG AAFGLFTQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRVALTLILAGALGNVGDILLY GKVVDFLSLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKKYF
Uniprot No.

Target Background

Function

This protein is a specific enzyme that catalyzes the removal of signal peptides from prolipoproteins.

Database Links

KEGG: ctr:CT_408

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Lipoprotein signal peptidase (LspA) in C. trachomatis?

LspA functions as a membrane enzyme responsible for cleaving the signal peptide from prolipoproteins during their maturation process. In C. trachomatis, this enzyme plays a critical role in the proper processing of lipoproteins that are essential for bacterial membrane integrity and function. The enzyme operates within a dynamic conformational framework that allows it to recognize, bind, and process substrate proteins with precision. Understanding this process is crucial for comprehending C. trachomatis pathogenesis and developing potential therapeutic interventions .

How does C. trachomatis LspA compare structurally to LspA in other bacterial species?

While specific structural comparisons for C. trachomatis LspA aren't directly detailed in the provided materials, research on LspA (such as that from Pseudomonas aeruginosa) reveals a dynamic protein with multiple conformational states. LspA typically features a β-cradle structure and a periplasmic helix (PH) that can adopt closed, intermediate, and open conformations. These conformational states are critical for substrate binding and enzymatic activity.

To compare C. trachomatis LspA to homologs in other species, researchers should:

  • Perform sequence alignments to identify conserved catalytic residues

  • Compare predicted structural models using homology modeling

  • Analyze key functional domains that might be subject to species-specific adaptations

  • Examine the protein's topology within the membrane environment, especially the accessibility of the active site

What are the essential experimental controls when working with recombinant C. trachomatis LspA?

When designing experiments with recombinant C. trachomatis LspA, researchers should implement the following essential controls:

  • Negative controls:

    • Empty vector expressions processed identically to your recombinant protein

    • Catalytically inactive mutants (via site-directed mutagenesis of conserved residues)

    • Membrane preparations from non-transformed bacterial hosts

  • Positive controls:

    • Well-characterized LspA from model organisms (e.g., E. coli or P. aeruginosa)

    • Synthetic substrate peptides with confirmed cleavage sites

  • Activity validation:

    • Enzyme activity assays with known substrates before and after purification steps

    • Mass spectrometry validation of cleavage products

    • Conformational state verification using spectroscopic methods

  • Expression verification:

    • Western blot confirmation with anti-His tag antibodies (for His-tagged proteins)

    • MALDI-TOF mass spectrometry for protein identity confirmation

How can the different conformational states of C. trachomatis LspA be experimentally measured and characterized?

Characterizing the conformational states of C. trachomatis LspA requires a multi-technique approach:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Continuous Wave (CW) EPR: Provides information about spin label mobility and local environment

    • Double Electron-Electron Resonance (DEER): Measures distances between specifically introduced spin labels

    • Site-directed spin labeling at strategic positions (e.g., the β-cradle and periplasmic helix)

  • Molecular Dynamics (MD) Simulations:

    • Coarse-grained simulations can model LspA behavior in membrane environments

    • All-atom simulations provide detailed conformational changes at nanosecond timescales

    • DEER-PREdict can be used to compare experimental and simulated distance distributions

  • X-ray Crystallography:

    • While challenging with membrane proteins, this provides high-resolution snapshots of stable conformations

    • Co-crystallization with inhibitors (like globomycin) to trap specific states

  • Analytical Methods for Data Integration:

    • Distance distribution analysis between labeled residues

    • Comparison of experimental DEER data with simulated distributions

    • Correlation of conformational states with functional outcomes

Based on studies of LspA proteins, researchers should expect to observe at least three distinct conformational states: closed (active site occluded), intermediate (partially accessible), and open (trigonal cavity for substrate binding). Each state can be characterized by specific distances between the β-cradle and periplasmic helix domains .

What methodological approaches are most effective for studying how inhibitors affect the conformational dynamics of C. trachomatis LspA?

To effectively study inhibitor effects on C. trachomatis LspA conformational dynamics:

  • Preparation of Inhibitor-Bound States:

    • Incubate purified LspA with inhibitors (e.g., globomycin) at various concentrations

    • Ensure complete binding by using excess inhibitor concentrations

    • Include appropriate controls with known inhibitors and non-inhibitors

  • Structural and Dynamic Analysis:

    • DEER EPR spectroscopy with spin-labeled protein to measure distance changes

    • Compare distance distributions between apo and inhibitor-bound states

    • CW EPR to detect changes in spin label mobility upon inhibitor binding

  • Computational Approaches:

    • MD simulations of inhibitor-bound versus apo states

    • Docking studies to predict binding modes

    • Free energy calculations to estimate binding affinities

  • Functional Correlation:

    • Enzymatic activity assays to correlate structural changes with inhibition

    • Thermal stability assays to assess stabilization effects

    • Kinetic measurements to determine inhibition mechanisms

  • Data Analysis Framework:

    • Multi-component fitting of EPR spectra to identify population distributions

    • Statistical comparison of distance distributions between states

    • Correlation of inhibitor binding with specific conformational changes

The data should be analyzed for population shifts among the three main conformational states (closed, intermediate, and open). For example, globomycin binding to LspA has been shown to affect the distribution of these conformational states, with evidence of multiple distance populations in the inhibitor-bound state .

What are the optimal expression systems and conditions for producing functional recombinant C. trachomatis LspA?

For optimal expression of functional recombinant C. trachomatis LspA:

  • Expression System Selection:

    • E. coli-based systems: BL21(DE3) or C43(DE3) strains are recommended for membrane proteins

    • Cell-free systems: Consider for toxic proteins that affect host viability

    • Eukaryotic systems: Insect cells may provide better folding for complex membrane proteins

  • Vector Design Considerations:

    • Include affinity tags (His-tag) for purification

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Include TEV protease cleavage sites for tag removal

    • Optimize codon usage for the expression host

  • Expression Conditions:

    • Temperature: Lower temperatures (16-20°C) often improve membrane protein folding

    • Induction: Use lower IPTG concentrations (0.1-0.5 mM) for slower, more controlled expression

    • Media: Consider auto-induction media or minimal media with specific supplements

    • Growth phase: Induce at mid-log phase (OD600 ~0.6) for optimal balance of yield and quality

  • Membrane Fraction Handling:

    • Prepare membrane fractions by ultracentrifugation (100,000g for 45 min)

    • Optimize detergent selection for solubilization (e.g., fos-choline-12 at 1.8% w/v)

    • Allow adequate time for solubilization (≥1 hour at 4°C with gentle agitation)

  • Quality Control Methods:

    • SDS-PAGE to assess purity

    • Western blot to confirm identity

    • MALDI-TOF mass spectrometry for molecular weight confirmation

    • Activity assays to verify functionality

How can researchers troubleshoot poor yield or activity of recombinant C. trachomatis LspA?

When encountering issues with recombinant C. trachomatis LspA production:

  • Expression Level Troubleshooting:

    • Verify construct sequence integrity and reading frame

    • Test multiple expression strains (BL21, C41/C43, Rosetta)

    • Adjust induction conditions (lower IPTG, longer expression times)

    • Try different media formulations (TB, LB, M9)

    • Consider codon optimization for rare codons in E. coli

  • Protein Solubility and Extraction:

    • Screen multiple detergents for membrane solubilization

    • Test different detergent concentrations and solubilization times

    • Consider alternative solubilization methods (e.g., SMA copolymers)

    • Optimize buffer components (salt concentration, pH, glycerol)

  • Purification Optimization:

    • Adjust imidazole concentrations in wash and elution buffers

    • Consider on-column detergent exchange

    • Test alternative chromatography methods (ion exchange, size exclusion)

    • Minimize exposure to air/oxidation during processing

  • Activity Restoration:

    • Verify proper buffer conditions (pH, salt, divalent cations)

    • Test lipid addition or reconstitution into nanodiscs/liposomes

    • Add stabilizing agents (glycerol, specific lipids)

    • Ensure removal of potential inhibitory contaminants

  • Systematic Analysis Approach:

    • Document each condition tested with corresponding yields

    • Analyze protein by multiple methods (Western blot, activity assays)

    • Compare activity to established benchmarks

    • Consider structural analysis (CD spectroscopy) to verify proper folding

How does genetic variation in the C. trachomatis lspA gene correlate with strain diversity and pathogenicity?

To investigate correlations between C. trachomatis lspA genetic variation and strain characteristics:

  • Genomic Analysis Approach:

    • Perform whole genome sequencing of diverse C. trachomatis strains

    • Extract and align lspA sequences from different biovars (trachoma, LGV)

    • Identify single nucleotide polymorphisms (SNPs) and insertion/deletion events

    • Create phylogenetic trees based on lspA sequence and compare with whole-genome phylogeny

  • Recombination Detection:

    • Apply specialized algorithms to detect recombination events affecting lspA

    • Compare with known recombination events in other C. trachomatis genes (e.g., ompA)

    • Determine if lspA shows evidence of horizontal gene transfer between strains

  • Structure-Function Correlation:

    • Map sequence variations to protein structural domains

    • Predict effects on protein function using computational tools

    • Experimentally verify effects of key variations on enzyme activity

  • Pathogenicity Association:

    • Correlate specific lspA variants with clinical outcomes or tissue tropism

    • Compare lspA sequences between ocular, urogenital, and LGV biovars

    • Test for association with virulence-related phenotypes in laboratory models

Unlike the extensively studied ompA gene, which shows significant recombination in C. trachomatis , less is known about variation in lspA. Researchers should be aware that relying on a single gene for phylogenetic analysis may be misleading due to extensive recombination in the C. trachomatis genome. A whole-genome SNP approach with recombination filtering should be used for the most accurate evolutionary reconstruction .

What methodological approaches are necessary to study potential interactions between LspA and other C. trachomatis virulence factors?

To investigate interactions between LspA and other C. trachomatis virulence factors:

  • Protein-Protein Interaction Screening:

    • Co-immunoprecipitation with anti-LspA antibodies

    • Bacterial two-hybrid or yeast two-hybrid systems adapted for membrane proteins

    • Proximity labeling approaches (BioID, APEX2) in heterologous systems

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Functional Interaction Assessment:

    • Gene co-expression analysis from transcriptomic data

    • Conditional knockout or depletion approaches

    • Phenotypic analysis of mutant combinations

    • Suppressor screening to identify genetic interactions

  • Localization Studies:

    • Immunofluorescence microscopy to detect co-localization

    • Super-resolution microscopy for detailed spatial relationships

    • Fractionation studies to identify compartmentalization

    • Live-cell imaging with fluorescently tagged proteins (where feasible)

  • Structural Biology Approaches:

    • Cryo-electron microscopy of protein complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Small-angle X-ray scattering for complex shape determination

    • Computational prediction of interaction sites

  • System-Level Analysis:

    • Network analysis of protein interactions

    • Integration of transcriptomic and proteomic data

    • Mapping to known virulence pathways

    • Correlation with stages of the developmental cycle

Researchers should be aware that studying protein interactions in obligate intracellular pathogens like C. trachomatis presents unique challenges, often requiring heterologous expression systems or sophisticated infection models. Additionally, membrane proteins like LspA require specialized approaches due to their hydrophobic nature and complex topology .

What are the advantages and limitations of different structural analysis techniques for studying C. trachomatis LspA?

Comparative Analysis of Structural Techniques for LspA:

TechniqueAdvantagesLimitationsOptimal Applications
X-ray Crystallography- High resolution atomic detail
- Visualizes bound ligands
- Captures stable conformations
- Challenging for membrane proteins
- Represents static snapshots
- Requires crystallization
- May not capture physiological states
- Detailed active site architecture
- Inhibitor binding modes
- Reference structures for other methods
Electron Paramagnetic Resonance (EPR)- Works in native-like membranes
- Captures dynamic information
- Measures specific distances
- Detects conformational populations
- Requires site-directed spin labeling
- Limited throughput
- Indirect structural information
- Potential spin label perturbation
- Conformational dynamics studies
- Measuring specific domain movements
- Detecting population distributions
Molecular Dynamics (MD) Simulation- Models dynamics over time
- Can include membrane environment
- Tests mechanistic hypotheses
- Integrates with experimental data
- Force field limitations
- Computational cost for long simulations
- Requires validation
- Limited timescales
- Predicting conformational changes
- Mechanism hypothesis testing
- Integrating with EPR data
Cryo-Electron Microscopy- No crystallization required
- Works with smaller amounts of protein
- Captures multiple conformations
- Handles large complexes
- Resolution challenges for small proteins
- Sample preparation issues
- Data processing complexity
- High equipment costs
- Structure of LspA complexes
- Visualization in larger assemblies
- Conformational ensemble analysis
Mass Spectrometry- Identifies post-translational modifications
- Hydrogen-deuterium exchange for dynamics
- Crosslinking for interaction mapping
- Minimal sample requirements
- Limited structural resolution
- Data interpretation complexity
- Indirect structural information
- Sample preparation artifacts
- Identifying modified residues
- Mapping solvent accessibility
- Detecting conformational changes

For studying LspA, a hybrid approach combining multiple techniques is most effective. For example, using EPR to measure distances between specific residues coupled with MD simulations can identify conformational states not observed in crystal structures alone. This combination enables the visualization and mapping of the conformational dynamics critical to LspA function in membrane environments .

How can researchers design experiments to resolve contradictory findings about C. trachomatis LspA structure or function?

When facing contradictory findings about C. trachomatis LspA:

As seen in studies of LspA conformational dynamics, proteins often exist in equilibrium between different states, and experimental conditions can shift these populations. Contradictory findings might represent different snapshots of a complex dynamic system rather than actual contradictions. Integrating data from multiple approaches (e.g., crystal structures, MD simulations, and EPR spectroscopy) provides a more complete understanding of the protein's behavior under different conditions .

What are the most significant unanswered questions about C. trachomatis LspA that warrant further investigation?

Several critical areas require further research regarding C. trachomatis LspA:

  • Structure-Function Relationships:

    • How do specific conformational states correlate with catalytic activity?

    • What molecular mechanisms control transitions between open, intermediate, and closed states?

    • How does membrane composition affect LspA dynamics and function?

  • Pathogen-Specific Adaptations:

    • Are there unique features of C. trachomatis LspA compared to homologs in other bacteria?

    • How is LspA activity regulated during different stages of the chlamydial developmental cycle?

    • Does LspA processing contribute to pathogen-specific virulence mechanisms?

  • Therapeutic Potential:

    • Can structure-based drug design yield C. trachomatis-specific LspA inhibitors?

    • What are the effects of known LspA inhibitors (like globomycin) on C. trachomatis infection?

    • How does inhibitor binding affect the conformational equilibrium of the enzyme?

  • Genomic and Evolutionary Aspects:

    • Is the lspA gene subject to recombination events similar to other C. trachomatis genes?

    • How conserved is LspA across different C. trachomatis serovars and strains?

    • What can comparative genomics reveal about LspA evolution and adaptation?

These questions should be addressed using integrated approaches that combine structural biology, biochemistry, molecular genetics, and computational methods to develop a comprehensive understanding of this essential enzyme in C. trachomatis biology .

How might advanced techniques like electron paramagnetic resonance spectroscopy and molecular dynamics simulations be optimized for future C. trachomatis LspA research?

Optimizing advanced techniques for future C. trachomatis LspA research:

  • Enhanced EPR Methodologies:

    • Develop optimized spin labeling strategies specific for C. trachomatis LspA

    • Implement pulse EPR techniques with improved sensitivity for membrane proteins

    • Design constructs with strategic cysteine pairs targeting key conformational transitions

    • Combine DEER EPR with rapid freeze-quench techniques to capture transient states

  • Refined Molecular Dynamics Approaches:

    • Develop specialized force fields for chlamydial membrane environments

    • Implement enhanced sampling techniques (metadynamics, replica exchange) to access longer timescales

    • Create hybrid QM/MM simulations for studying catalytic mechanisms

    • Utilize machine learning approaches to identify relevant conformational substates

  • Integration Methodologies:

    • Develop computational frameworks that directly incorporate EPR constraints into MD simulations

    • Implement Bayesian statistical approaches for integrating multiple experimental datasets

    • Create automated analysis pipelines for correlating simulated and experimental distance distributions

    • Design validation experiments to test predictions from computational models

  • Technical Considerations:

    • Optimize membrane mimetics for maintaining native-like LspA conformational equilibrium

    • Develop non-perturbing site-specific labels for EPR beyond traditional spin labels

    • Improve computational efficiency to enable microsecond-scale simulations of full systems

    • Create standardized protocols for comparing results across different research groups

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.