Recombinant Chlamydia trachomatis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Chlamydia trachomatis Membrane Protein Insertase YidC (yidC) is a genetically engineered version of the YidC protein expressed in Escherichia coli for structural and functional studies. YidC is a conserved membrane integrase critical for the insertion, folding, and assembly of α-helical membrane proteins in Gram-negative bacteria . In C. trachomatis, YidC plays a pivotal role in membrane protein biogenesis, particularly for virulence factors and energy-transducing complexes .

Mechanism of Action

  • Substrate Binding: YidC binds nascent membrane proteins within 2 ms via its cytoplasmic α-helical hairpin, exhibiting high conformational flexibility .

  • Insertion Process: Transfers substrates to the membrane within 52 ms using its hydrophilic groove, stabilizing transmembrane helices in a low-variability folded state .

Expression System

  • Host: E. coli (BL21 or similar strains) .

  • Vector: Utilizes low-copy plasmids with moderate-strength promoters (e.g., T7 or λPL) to optimize yield .

  • Tag: N-terminal His-tag for affinity purification .

Purification Protocol

ParameterDetail
Expression VectorpAT153 (colE1 origin, low copy number)
InductionIPTG (0.1–1.0 mM)
PurificationNickel-affinity chromatography followed by size-exclusion chromatography
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)

In Vitro Functional Studies

  • Sec-Independent Insertion: Reconstitution assays demonstrate YidC’s sufficiency for inserting Pf3 coat protein into inverted membrane vesicles without Sec translocon components .

  • Energy Efficiency: Operates independently of ATP hydrolysis, relying on membrane potential (ΔΨ) for activity .

In Vivo Relevance

  • Genetic Context: In C. trachomatis, yidC is part of a conserved gene cluster linked to membrane protein biogenesis .

  • Role in Pathogenesis: Critical for virulence factor assembly, including outer membrane proteins (e.g., MOMP) .

Applications in Vaccine Development

YidC’s role in membrane protein biogenesis has been leveraged for recombinant antigen production:

  • MOMP Expression: Codon harmonization and YidC-assisted folding enabled functional expression of C. trachomatis MOMP in E. coli outer membranes, yielding immunogenic candidates .

  • Antibody Response: Mice immunized with YidC-assisted MOMP elicited antibodies reactive to native Chlamydia elementary bodies (EBs) .

Challenges and Limitations

  • Solubility Issues: Recombinant YidC requires detergents (e.g., DDM) for stabilization during purification .

  • Functional Redundancy: Partial functional overlap with Sec translocon complicates mechanistic studies .

Future Directions

  • Structural Resolution: Cryo-EM studies to resolve substrate-insertase interactions at atomic resolution .

  • Drug Targeting: Exploiting YidC’s hydrophilic groove for designing inhibitors against C. trachomatis infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; CT_251; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-787
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
yidC
Target Protein Sequence
CQIFFGYRDLKSCQDLAEKQRAISEQILASTEQLSVVPWTASLEESESVNQYAIRLGNRL LLLTKGGSHPEVYSRGTYWSLIEQTSTFGGILVSLYGETGQEVLSKGSSVYLPNQRDAFP VLVAEFRSNQEPLVFLGEYKDGKIANKAGAIYGTSLVFLNTGNGFVPLGIYNSKEECVES LDLPMARAVVFADKENPTASGSYYMLSNEYMQIVVSQESGAIEGINLPFASDQEENKSIV NEIGFDRELAINSPSEASFPGVETIDSQRQNIANVVGGYYPLLRRGTLSDVKKRVPAQYQ ALNIVSGRELASPVATGFRVVSFDNKTLILESGDGGIRRTYSLGEQPYAFELEIQTTQGR EDLWITSGVPEVEIMSNAFVPAVKYHAVKKNKSDLFNVKLPKAKDSLLVRNNATPQWILN SNGYFGVILTPRIPIPAGYASSFIPGNVVPTRLSQLPPKDQAYPASKYPGYTAMLPLPKE AGRYQFMVYAGPLADPTLKALDRANANSKGETPEYVDAIAFRGFFSFITEPFAALLFVIM KFFKFLTGSWGISIILLTIVLKLLLYPLNAWSIRSMRRMQKLSPYIQEIQQKYKREPKRA QMEIMALYKMNKVNPITGCLPLLIQIPFLIAMFDLLKSSFLLRGASFIPGWIDNLTAPDV LFSWETPIWFIGKEFHLLPILLGVVMFAQQKISAVKRSGPASDQQRQQEAMGTMMALLFT FMFYNFPSGLNIYWFSSMLLGVIQQWVTNKILDEKHLQHEVIINKKR
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins, both dependent and independent of the Sec translocase complex, as well as at least some lipoproteins. Additionally, it aids in the folding of multispanning membrane proteins.
Database Links

KEGG: ctr:CT_251

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in bacterial systems?

YidC is a critical membrane protein insertase that plays an essential role in the biogenesis of membrane proteins. YidC facilitates the insertion, folding, and assembly of various membrane proteins through both Sec-dependent and Sec-independent pathways. In bacteria, YidC functions as a molecular chaperone that guides the proper folding and insertion of nascent membrane proteins into the lipid bilayer .

The insertase activity of YidC is particularly important for membrane proteins that must be correctly oriented and folded within the membrane to function properly. Recent studies have demonstrated that YidC provides a hydrophilic groove that serves as an insertion site for transmembrane segments of client proteins, allowing them to be properly integrated into the lipid bilayer .

How does the structure of YidC contribute to its function?

The crystal structure of YidC reveals several key structural features that facilitate its function:

  • A hydrophilic groove within the transmembrane region that creates a favorable environment for membrane protein insertion

  • Cytoplasmic loops that make initial contact with substrate proteins

  • Critical charged residues (particularly R72 in some YidC proteins) that form salt bridges with substrate proteins

  • A periplasmic domain that may assist in the final stages of protein insertion

Based on molecular dynamics simulations, YidC undergoes significant conformational changes during the insertion process, with the protein's RMSD fluctuating more during the initial stages of insertion (pose 1) compared to later stages (pose 2), suggesting substantial structural rearrangements occur to accommodate substrate proteins .

What expression systems are most effective for recombinant Chlamydia trachomatis YidC production?

For membrane proteins like YidC, several expression systems can be considered, with each offering distinct advantages:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yield, economical, rapid growthPotential toxicity, inclusion body formationUse C41(DE3) or C43(DE3) strains designed for membrane proteins
Insect cellsBetter folding for complex proteinsHigher cost, slower productionBaculovirus expression with optimized signal sequences
Cell-free systemsAvoids toxicity issues, direct membrane incorporationLower yields, higher costSupplement with lipids or nanodiscs
Yeast systemsPost-translational modifications, good for eukaryotic proteinsDifferent membrane compositionUse Pichia pastoris for higher yields

When working with Chlamydia trachomatis YidC specifically, codon optimization for the expression host is particularly important due to the different codon usage between Chlamydia and common expression hosts.

What computational approaches are valuable for studying YidC-mediated membrane insertion?

Molecular dynamics (MD) simulations have proven particularly valuable for studying the conformational dynamics of YidC during membrane protein insertion. Based on the research findings, several computational approaches can be employed:

  • All-atom MD simulations: These have been successfully used to characterize conformational differences in YidC during different stages of the insertion process. These simulations typically use force fields such as CHARMM36m within software like NAMD .

  • Biased simulation methods: Techniques such as targeted MD (TMD) can be employed to study transitions between different states of the insertion process, as demonstrated in studies of YidC-mediated insertion of the Pf3 coat protein .

  • Lipid bilayer modeling: Creating accurate membrane environments using lipids such as palmitoyloleoyl phosphatidylethanolamine (POPE) is crucial for realistic simulations .

  • Principal Component Analysis (PCA): This technique is valuable for identifying the major conformational changes in YidC during the insertion process .

  • Protein-protein docking: Creating initial poses of substrate proteins interacting with YidC can provide starting points for more detailed simulations .

Implementation typically requires high-performance computing resources, as demonstrated by studies that utilized resources such as Blue Waters and Extreme Science and Engineering Discovery Environment (XSEDE) .

What experimental techniques are most effective for characterizing YidC-substrate interactions?

Several complementary experimental approaches can be employed to study YidC-substrate interactions:

  • Site-directed mutagenesis: Creating specific mutations in key residues of YidC (such as R72) or in substrate proteins to assess their importance in the insertion process. Studies have identified critical salt bridge interactions that can be disrupted through this approach .

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify points of contact between YidC and its substrate proteins.

  • FRET (Förster Resonance Energy Transfer): This technique can monitor real-time conformational changes and interactions between YidC and its substrates.

  • Proteoliposome reconstitution assays: Purified YidC can be reconstituted into liposomes to study its activity in a controlled membrane environment.

  • In vivo depletion studies: Conditional depletion of YidC in bacterial strains allows assessment of which membrane proteins depend on YidC for proper insertion and function .

When designing these experiments, it's important to consider the dynamic nature of YidC-substrate interactions, as YidC undergoes significant conformational changes during the insertion process .

What is the proposed mechanism for YidC-mediated membrane protein insertion?

Based on equilibrium and non-equilibrium simulations, the following mechanism has been proposed for YidC-mediated Sec-independent insertion:

  • Initial interaction: The substrate protein first interacts with the cytoplasmic loops of YidC.

  • Hydrophilic groove entry: The substrate then moves into the hydrophilic groove within the transmembrane region of YidC.

  • Salt bridge formation: Critical electrostatic interactions form between charged residues of YidC (such as R72) and the substrate protein. For example, the negatively charged D7 residue of the Pf3 coat protein forms a salt bridge with the positively charged R72 of YidC .

  • Conformational changes: During this process, YidC undergoes significant conformational changes, which can be observed through increased RMSD values (approximately 2Å higher in the initial insertion stage compared to later stages) .

  • Substrate migration: The substrate protein then migrates further into the groove, breaking initial salt bridges and forming new interactions.

  • Groove dehydration: The hydrophilic groove becomes dehydrated as the process continues.

  • Periplasmic transition: Finally, the substrate protein moves toward the periplasmic side of the membrane, assisted by hydrophobic interactions with lipid tails .

This process demonstrates the crucial chaperone and insertase functions of YidC in guiding proper membrane protein integration.

What structural dynamics occur in YidC during the membrane insertion process?

YidC undergoes significant conformational changes during the membrane protein insertion process:

These dynamics highlight the remarkable structural flexibility of YidC that enables it to facilitate membrane protein insertion efficiently.

How can site-directed mutagenesis be applied to study functional residues in YidC?

Site-directed mutagenesis is a powerful approach for identifying critical residues in YidC that are essential for its insertase function:

  • Identification of target residues: Based on computational studies and sequence conservation analysis, key residues such as R72 have been identified as potential targets for mutagenesis .

  • Charge-reversal mutations: Converting positively charged residues to negatively charged ones (e.g., R72E) can disrupt critical salt bridge interactions with substrate proteins .

  • Hydrophobicity alterations: Changing hydrophobic residues within the groove to hydrophilic ones can affect the dehydration process during insertion.

  • Loop flexibility modifications: Introducing proline residues into cytoplasmic loops can restrict conformational flexibility and impact initial substrate recognition.

  • Cysteine substitutions: Introducing cysteine residues at specific positions can facilitate subsequent cross-linking studies to map interaction sites.

When designing mutagenesis experiments for Chlamydia trachomatis YidC, researchers should focus on residues that are conserved across species as well as those that might be unique to Chlamydia, which could reveal pathogen-specific functional adaptations.

What are the major challenges in expressing and purifying functional recombinant YidC?

Researchers face several challenges when working with recombinant YidC:

  • Membrane protein toxicity: Overexpression of membrane proteins like YidC can be toxic to host cells.

    • Solution: Use specialized expression strains designed for membrane proteins (C41/C43) or tightly regulated expression systems.

  • Proper membrane insertion: Ensuring recombinant YidC is correctly inserted into the membrane of the expression host.

    • Solution: Use appropriate signal sequences and optimize induction conditions (temperature, inducer concentration).

  • Detergent selection: Choosing appropriate detergents for extraction that maintain protein function.

    • Solution: Screen multiple detergents (DDM, LMNG, etc.) and detergent:protein ratios.

  • Maintaining stability: Preventing aggregation during purification.

    • Solution: Include stabilizing lipids or cholesterol hemisuccinate during purification.

  • Functional assessment: Verifying that purified YidC retains its native insertase activity.

    • Solution: Develop robust functional assays using model substrates like Pf3 coat protein .

A systematic approach to optimization is typically necessary, with careful monitoring of protein quality at each step of the purification process.

What methods can be used to verify the correct folding and activity of purified YidC?

Several complementary techniques can assess the proper folding and activity of purified YidC:

For functional assessment specifically, reconstituting purified YidC into proteoliposomes and measuring its ability to insert model substrates like Pf3 coat protein provides the most direct evidence of proper folding and activity .

What is the potential significance of YidC in Chlamydia trachomatis pathogenesis?

While the search results don't directly address the role of YidC in Chlamydia trachomatis pathogenesis, several logical connections can be made:

  • Membrane protein biogenesis: As an obligate intracellular pathogen, Chlamydia trachomatis depends on proper membrane protein insertion for survival and virulence. YidC likely plays a crucial role in ensuring correct assembly of virulence factors and transport proteins .

  • Inclusion membrane proteins: Chlamydia trachomatis produces inclusion membrane proteins (Incs) that are critical for intracellular survival. While the search results focus on Inc proteins B and C as antigens , the proper insertion of these proteins likely depends on membrane insertion machinery that could include YidC.

  • Host-pathogen interactions: Membrane proteins are at the interface between the pathogen and host, and their proper insertion and folding are essential for host cell manipulation .

  • Developmental cycle: Chlamydia has a unique biphasic developmental cycle that involves transitions between elementary bodies (EBs) and reticulate bodies (RBs), which likely requires precise regulation of membrane protein biogenesis .

Further research specifically focusing on Chlamydia trachomatis YidC is needed to elucidate its exact role in pathogenesis and potential as a therapeutic target.

How might advances in understanding YidC function contribute to novel antimicrobial strategies?

The essential role of YidC in bacterial membrane protein biogenesis makes it a potential target for novel antimicrobial strategies:

  • YidC inhibitors: Compounds that specifically target the hydrophilic groove or critical residues (such as R72) could disrupt YidC function and thereby inhibit proper membrane protein insertion .

  • Disruption of salt bridge formation: Small molecules designed to interfere with the critical salt bridge interactions between YidC and its substrates could impair bacterial viability .

  • Chlamydia-specific targeting: If unique structural features of Chlamydia trachomatis YidC can be identified, these could be exploited to develop pathogen-specific inhibitors with reduced effects on commensal bacteria.

  • Combination therapies: YidC inhibitors could potentially be combined with existing antibiotics to enhance efficacy, particularly against pathogens with established antibiotic resistance .

  • Vaccine development: Understanding YidC's role in the proper assembly of surface antigens could inform vaccine development strategies against Chlamydia trachomatis.

The development of such strategies would require detailed structural and functional characterization of Chlamydia trachomatis YidC, along with high-throughput screening approaches to identify potential inhibitors.

How does Chlamydia trachomatis YidC compare to YidC homologs in other bacteria?

While the search results don't provide direct comparative analysis of Chlamydia trachomatis YidC with other bacterial homologs, several aspects typically differ between bacterial species:

  • Sequence conservation: The core functional domains of YidC are generally conserved across bacteria, but sequence variations exist, particularly in the periplasmic domains and cytoplasmic loops.

  • Substrate specificity: Different bacterial YidC proteins may have evolved to handle specific sets of substrate proteins related to the organism's lifestyle and environmental niche.

  • Interaction partners: YidC from different bacteria may have evolved different patterns of interaction with other membrane protein insertion machinery, such as the SecYEG translocon.

  • Structural adaptations: As an obligate intracellular pathogen, Chlamydia trachomatis may have evolved structural adaptations in YidC to function within the unique environment of the inclusion body and to handle pathogen-specific membrane proteins.

Comparative genomic and structural analyses would be valuable to identify unique features of Chlamydia trachomatis YidC that might be exploited for pathogen-specific targeting.

What experimental approaches can be used to study differences in substrate specificity between YidC homologs?

Several experimental approaches can be employed to investigate differences in substrate specificity between YidC homologs from different bacterial species:

  • Complementation studies: Express Chlamydia trachomatis YidC in YidC-depleted E. coli strains to determine if it can complement the loss of endogenous YidC, and which substrates can or cannot be properly inserted .

  • Substrate profiling: Use proteomic approaches to identify the complete set of substrates that depend on YidC in different bacterial species.

  • Domain swapping: Create chimeric YidC proteins with domains from different bacterial species to identify regions responsible for substrate specificity.

  • In vitro reconstitution: Purify YidC proteins from different bacteria and compare their ability to insert a panel of model substrates in reconstituted proteoliposome systems .

  • Structural studies: Compare the structures of YidC hydrophilic grooves across species to identify differences that might contribute to substrate specificity.

These approaches would provide valuable insights into the evolutionary adaptations of YidC across bacterial species and potentially reveal pathogen-specific features that could be exploited for therapeutic development.

What are the most promising future research directions for Chlamydia trachomatis YidC studies?

Several promising research directions could advance our understanding of Chlamydia trachomatis YidC:

  • Structural determination: Obtaining high-resolution structures of Chlamydia trachomatis YidC, ideally in complex with substrates, would provide crucial insights into its function and potential for targeting.

  • Developmental regulation: Investigating how YidC expression and function might be regulated during the different stages of the Chlamydia developmental cycle.

  • Host-pathogen interface: Exploring how YidC-dependent membrane proteins contribute to host-pathogen interactions and intracellular survival.

  • Inhibitor development: High-throughput screening for compounds that specifically inhibit Chlamydia trachomatis YidC function, possibly targeting the hydrophilic groove or critical salt bridge interactions .

  • Systems biology approaches: Integrating YidC studies with global analyses of the Chlamydia membrane proteome to understand its role in the broader context of pathogen biology.

These research directions would benefit from combining computational approaches, such as those detailed in search result , with experimental validation using both in vitro and in vivo systems.

What are the key considerations when designing molecular dynamics simulations for studying YidC?

Based on the detailed molecular dynamics studies described in search result , several key considerations are important when designing simulations for YidC:

  • System preparation: Careful preparation of the YidC structure is essential, including proper protonation states of residues using tools like MOE's protonate3D facility .

  • Membrane environment: Creating a realistic membrane environment is critical, with appropriate lipid composition such as POPE lipids arranged in a bilayer along the XY plane .

  • Water and ion modeling: Proper solvation with water layers (approximately 25 Å thick) above and below the membrane, and appropriate ion concentrations (e.g., 0.15 M Na+ and Cl-) are important for realistic simulations .

  • Force field selection: The choice of force field significantly impacts results, with CHARMM36m being successfully used for YidC simulations .

  • Equilibration protocol: A careful equilibration protocol with progressive relaxation of the system is crucial before production simulations .

  • Simulation time: Sufficient simulation time (≥500 ns) is necessary to observe relevant conformational changes in YidC during the insertion process .

  • Analysis approach: Comprehensive analysis techniques including RMSD calculations, bending angle analysis, salt bridge monitoring, and principal component analysis provide insights into different aspects of YidC function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.