Recombinant Chlamydia trachomatis Probable Na (+)-translocating NADH-quinone reductase subunit C

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydia trachomatis Probable Na(+)-translocating NADH-quinone reductase subunit C

The Recombinant Chlamydia trachomatis Probable Na(+)-translocating NADH-quinone reductase subunit C is a recombinant protein derived from the bacterium Chlamydia trachomatis. This protein is part of the Na(+)-translocating NADH-quinone reductase (Na+-NQR) complex, which plays a crucial role in the respiratory metabolism of C. trachomatis. The Na+-NQR complex is unique in that it pumps sodium ions across the membrane while catalyzing the electron transfer from NADH to quinone, unlike the proton-pumping NADH:ubiquinone oxidoreductase found in mitochondria .

Function of Subunit C in Na+-NQR

ComponentFunction
FMN CofactorInvolved in electron transfer during the reduction of ubiquinone to ubiquinol .
Sodium PumpingContributes to the generation of a sodium gradient across the membrane .

Research Findings and Implications

Research on C. trachomatis has shown that the Na+-NQR complex is vital for the bacterium's energy metabolism. Inhibiting this complex with HQNO, a specific inhibitor of Na+-NQR, significantly impacts the bacterium's growth and inclusion size within host cells . The use of recombinant proteins like the Na(+)-translocating NADH-quinone reductase subunit C facilitates detailed studies of these processes.

Impact of Na+-NQR Inhibition

InhibitorEffect on C. trachomatis
HQNODecreases chlamydial protein levels and inclusion size .
MonensinCompletely halts infection by disrupting the sodium gradient .

Recombinant Protein Production and Applications

Recombinant proteins are produced using genetic engineering techniques, allowing for the expression of specific proteins in host organisms. The Recombinant Chlamydia trachomatis Probable Na(+)-translocating NADH-quinone reductase subunit C is available in various sizes, such as 50 μg, and can be used in research settings to study the Na+-NQR complex's structure and function .

Applications of Recombinant Proteins

  1. Structural Studies: Recombinant proteins can be used to determine the three-dimensional structure of the Na+-NQR complex, providing insights into its mechanism of action.

  2. Functional Assays: These proteins can be used in biochemical assays to study the electron transfer process and sodium pumping activity.

  3. Vaccine Development: Understanding the function of Na+-NQR could lead to the development of targeted therapies or vaccines against C. trachomatis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
nqrC; nqr3; CT_279; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
nqrC
Target Protein Sequence
MASKSRHYLNQPWYIILFIFVLSLIAGTLLSSVYYVLAPIQQQAAEFDRNQQMLMAAQVI SSDNTFQVYEKGDWHPALYNTKKQLLEISSTPPKVTVTTLSSYFQNFVRVLLTDTQGNLS SFEDHNLNLEEFLSQPTPVIHGLALYVVYAILHNDAASSKLSASQVAKNPTAIESIVLPI EGFGLWGPIYGFLALEKDGNTVLGTSWYQHGETPGLGANIANPQWQKNFRGKKVFLVSAS GETDFAKTTLGLEVIKGSVSAALGDSPKAASSIDGISGATLTCNGVTESFSHSLAPYRAL LTFFANSKPSGESHDH
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with Na+ ion transport from the cytoplasm to the periplasm. NqrA to NqrE likely participate in the second step, converting ubisemiquinone to ubiquinol.

Database Links

KEGG: ctr:CT_279

Protein Families
NqrC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of Na(+)-NQR in Chlamydia trachomatis metabolism?

Na(+)-NQR (sodium-dependent NADH:quinone oxidoreductase) serves as a critical component of C. trachomatis energy metabolism. This respiratory complex incorporates electrons from NADH into the quinone pool while simultaneously pumping sodium ions across the bacterial membrane. Unlike the mitochondrial Complex I, which generates a proton gradient, Na(+)-NQR specifically creates a sodium gradient that energizes the bacterial membrane . This sodium gradient is essential for various physiological processes, including nutrient transport and pH regulation . Remarkably, Na(+)-NQR represents the only sodium pump identified in C. trachomatis, highlighting its significance in the bacterium's energy production system .

How does the Na(+)-NQR complex differ structurally from mitochondrial Complex I?

While Na(+)-NQR catalyzes a similar net redox reaction as mitochondrial Complex I (transferring electrons from NADH to quinone), the two enzymes are fundamentally different in their structure, composition, and mechanism:

FeatureC. trachomatis Na(+)-NQRMitochondrial Complex I
Ion specificityNa+ translocatingH+ (proton) translocating
Electron carrierMenaquinoneUbiquinone
Key cofactorsNon-covalent FAD, 2Fe-2S center, covalently bound FMNs, riboflavinFMN, multiple iron-sulfur clusters
Inhibitor sensitivityHQNO, korormicinRotenone, other Complex I inhibitors
Evolutionary originClosely related to RNF complexDifferent evolutionary origin

The Na(+)-NQR complex contains specialized subunits including NqrC, which contains a covalently bound FMN (FMNC) . This structural difference contributes to the unique mechanism by which Na(+)-NQR couples electron transport to sodium translocation .

What are the most effective methods for measuring Na(+)-NQR activity in C. trachomatis?

Investigating Na(+)-NQR activity in C. trachomatis requires specialized techniques due to the bacterium's obligate intracellular lifestyle. Based on current research methods:

  • Oxygen consumption measurements: Researchers can assess Na(+)-NQR activity by measuring oxygen consumption in infected cells using high-resolution respirometry. The Na(+)-NQR-specific component can be identified as the portion of respiration that is resistant to mitochondrial respiratory chain inhibitors (like rotenone) but sensitive to HQNO (a Na(+)-NQR inhibitor) .

  • Permeabilized cell systems: A powerful approach involves harvesting infected cells and permeabilizing them with precisely titrated digitonin concentrations (20 μg/ml per 5×10^6 cells). This method preserves chlamydial membrane integrity while allowing access to respiratory substrates like α-ketoglutarate. In this system, Na(+)-NQR activity manifests as an HQNO-sensitive and ADP-stimulated oxygen consumption, exhibiting state 3/state 4-like transitions reminiscent of mitochondrial respiration .

  • Inhibitor titration analysis: To confirm specific Na(+)-NQR activity, performing inhibitor titration with HQNO on the rotenone-insensitive oxygen consumption provides a characteristic inhibition curve. The inhibition constant (Ki) for HQNO action on C. trachomatis Na(+)-NQR is approximately 0.1 ± 0.03 μM, similar to values reported for Na(+)-NQR in other bacteria .

How can researchers express and purify recombinant Na(+)-NQR subunit C from C. trachomatis?

Expression and purification of recombinant NqrC from C. trachomatis presents several technical challenges that require specific methodological considerations:

  • Expression system selection: Due to the presence of covalently bound FMN in NqrC, expression in E. coli systems requires co-expression of the flavin-transferase enzyme to ensure proper cofactor attachment. Alternatively, specialized chlamydial expression systems using controlled transposon delivery vectors, such as those based on the pSW2-RiboA-C9Q plasmid, offer an approach for expression within chlamydia .

  • Induction protocol optimization: For expression within chlamydial systems, dual regulation using both tetracycline-responsive elements (induced with ATc at 2 ng/ml) and riboswitch-based control elements may provide tighter expression control. Induction at 24 hours post-infection yields optimal results, with protein harvesting conducted 18-24 hours after induction to allow completion of the developmental cycle .

  • Affinity purification strategy: For purification of recombinant NqrC, a polyhistidine tag approach combined with immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography is recommended. Special care must be taken to maintain the native conformation and cofactor association during purification by including appropriate detergents and avoiding strong reducing agents that might disrupt the covalent flavin attachment.

How does the redox potential of NqrC position it in the electron transport chain of C. trachomatis?

The redox potential of NqrC's covalently bound FMN plays a crucial role in determining its position within the C. trachomatis electron transport chain. The electron transfer pathway in the Na(+)-NQR complex follows a specific sequence:

  • NADH → Non-covalently bound FAD in NqrF

  • FAD → 2Fe-2S center in NqrF

  • 2Fe-2S → Covalently bound FMNs in NqrB and NqrC

  • FMNs → Riboflavin (likely in NqrB)

  • Riboflavin → Quinone (menaquinone in C. trachomatis)

What are the key differences in Na(+)-NQR function between different developmental stages of C. trachomatis?

The functionality and importance of Na(+)-NQR vary across the developmental cycle of C. trachomatis, reflecting changing energetic requirements:

Developmental StageNa(+)-NQR RoleEffect of HQNO InhibitionATP Source
Early (1-12 hpi)Less activeDecreases chlamydial protein level and inclusion size, but not infection ratePrimarily host-derived ATP
Mid-stageHighly activeReduces inclusion sizeIncreasingly self-generated ATP
Late stageCriticalAffects RB growthPredominantly self-generated ATP

This dynamic relationship with host energy metabolism reveals that early in infection, C. trachomatis depends heavily on host ATP synthesis. As infection progresses, the bacterium increasingly relies on its own energy generation mechanisms through Na(+)-NQR activity . This transition represents a strategic adaptation that optimizes energy utilization throughout the developmental cycle.

How do specific inhibitors of Na(+)-NQR affect C. trachomatis growth and development?

Two major classes of inhibitors have demonstrated significant effects on Na(+)-NQR function in C. trachomatis, with distinct implications for bacterial development:

These inhibition patterns confirm that C. trachomatis generates a sodium gradient to energize its membrane, which is essential for both infection establishment and bacterial growth.

What ionic conditions optimize Na(+)-NQR activity in experimental settings?

Optimal Na(+)-NQR activity requires carefully controlled ionic conditions that reflect the complex regulatory mechanisms affecting this enzyme:

  • Sodium concentration: As the primary ion transported by Na(+)-NQR, sodium is essential for enzyme activity. Based on studies in related bacterial systems, optimal Na+ concentrations typically range from 100-200 mM, though the specific affinity may vary for C. trachomatis .

  • Potassium effects: Research on Na(+)-NQR from other bacteria indicates that K+ can increase enzyme activity by 10-20% and double the affinity for Na+ through binding to a regulatory site . This suggests that maintaining physiological K+ levels (approximately 140 mM) in experimental buffers may optimize NqrC function.

  • Other cations: Rubidium ions can compete with K+ for binding to the regulatory site but have an inhibitory effect on enzyme activity . Li+ can be transported by Na(+)-NQR in place of Na+, though typically with altered kinetics.

  • pH considerations: While not explicitly stated in the search results, Na+/H+ antiporter activity is typically pH-dependent, suggesting that maintaining pH between 7.0-7.5 would likely provide optimal conditions for assessing Na(+)-NQR function.

For in vitro studies of recombinant NqrC, these ionic parameters should be carefully controlled to replicate the physiological environment of the C. trachomatis inclusion.

How can transposon mutagenesis approaches be applied to study Na(+)-NQR function in C. trachomatis?

Recent developments in genetic manipulation techniques for C. trachomatis offer promising approaches for investigating Na(+)-NQR function through transposon mutagenesis:

  • Optimized vector systems: The pSW2-RiboA-C9Q vector system represents a breakthrough for creating stable transposon mutants in C. trachomatis. This system incorporates a tightly regulated transposase with reduced activity compared to hyperactive variants, enabling the generation and maintenance of stable transformants .

  • Induction protocols: For successful transposon mutagenesis targeting Na(+)-NQR components, induction of transposase expression at 24 hours post-infection using ATc (2 ng/ml) and theophylline (2 mM) allows sufficient time for expansion of potential mutants. DNA extraction performed 18-24 hours after induction captures the diversity of insertions .

  • Sequencing approaches: MinION long-read sequencing has successfully identified dozens of individual transposon insertions in a single induction experiment, though this likely underrepresents the actual number of insertions. High-throughput sequencing approaches would reveal more comprehensive mutant libraries .

  • Targeted screening strategy: For NqrC-specific studies, researchers could develop a screening strategy based on HQNO resistance or hypersensitivity, allowing enrichment for mutants with altered Na(+)-NQR function. Alternatively, fluorescent reporters linked to sodium gradient formation could enable visualization-based screening approaches.

This transposon mutagenesis approach offers unprecedented opportunities to create defined mutations in NqrC and other Na(+)-NQR components, enabling detailed structure-function analysis.

What are the most promising approaches for developing specific inhibitors of C. trachomatis Na(+)-NQR subunit C?

Developing specific inhibitors against C. trachomatis NqrC represents a potential therapeutic strategy that exploits the unique aspects of chlamydial energy metabolism:

  • Structure-guided design: While the full structure of C. trachomatis Na(+)-NQR remains to be determined, the available information on the NqrF subunits from related organisms like V. cholerae provides structural insights that could guide inhibitor design . Targeting the covalent attachment site of FMN in NqrC could yield highly specific inhibitors.

  • Natural product screening: The success of korormicin (produced by Pseudoalteromonas sp. F-420) as a potent Na(+)-NQR inhibitor (Ki of 80 pM) suggests that marine and other microbial sources may yield novel inhibitor scaffolds with high potency and specificity . A focused natural product screening campaign could identify compounds with activity against C. trachomatis NqrC.

  • Quinone analog development: Both HQNO and korormicin are quinone analogs that occupy the same site on Na(+)-NQR . Structural modifications of these compounds, guided by the specific quinone (menaquinone) used by C. trachomatis, could yield improved inhibitors with enhanced specificity for the chlamydial enzyme.

  • Flavin binding site targeting: Given the critical role of the covalently bound FMN in NqrC function, compounds that interfere with flavin binding or electron transfer through this cofactor could selectively disrupt Na(+)-NQR activity without affecting host mitochondrial functions.

The significant differences between Na(+)-NQR and mitochondrial Complex I offer opportunities for developing inhibitors with high selectivity for the bacterial enzyme, potentially leading to novel therapeutic approaches for chlamydial infections.

How does the sodium gradient generated by Na(+)-NQR contribute to C. trachomatis pathogenesis?

The sodium gradient established by Na(+)-NQR activity plays multi-faceted roles in C. trachomatis pathogenesis:

The dynamic relationship between C. trachomatis and host cell energy metabolism throughout infection highlights the sophisticated energy parasitism strategies employed by this obligate intracellular pathogen .

What evidence suggests that targeting Na(+)-NQR could be an effective strategy against persistent chlamydial infections?

Several lines of evidence indicate that Na(+)-NQR represents a promising target for addressing persistent chlamydial infections:

  • Differential energy requirements: The dynamic relationship between C. trachomatis and host energy metabolism changes throughout infection, with early-stage bacteria depending primarily on host ATP and later-stage bacteria increasingly relying on their own energy generation through Na(+)-NQR . This suggests that Na(+)-NQR inhibitors might be particularly effective against established, persistent infections.

  • Essential for reticulate body growth: HQNO treatment significantly decreases chlamydial protein levels and inclusion size, indicating that Na(+)-NQR activity is crucial for RB growth and division . Since persistent infections typically involve non-dividing, aberrant RBs, targeting the energy systems required for RB metabolism could disrupt persistence.

  • Unique target not present in host cells: The Na(+)-NQR complex represents a bacterial-specific target without a direct homolog in human cells, offering potential for selective toxicity . This contrasts with some current anti-chlamydial agents that may also affect host cell functions.

  • Catastrophic effects of sodium gradient disruption: The observation that monensin treatment completely halts chlamydial infection demonstrates the critical nature of the sodium gradient for chlamydial viability . This suggests that even partial inhibition of Na(+)-NQR might significantly impair chlamydial survival and persistence.

The central role of energy metabolism in supporting persistent infection, combined with the unique nature of the Na(+)-NQR complex, positions this enzyme as a promising target for next-generation therapeutic approaches against recalcitrant chlamydial infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.