Recombinant Chlamydia trachomatis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Host Systems and Production

Recombinant Lgt is expressed in multiple heterologous systems to ensure high yield and purity:

ParameterDetails
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells, or Cell-Free Expression .
Purity≥85% (verified by SDS-PAGE) .
Storage-20°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw .

Functional Role in C. trachomatis

Lgt is indispensable for lipoprotein maturation, which influences:

  • Membrane integrity: Anchors virulence factors to the bacterial outer membrane .

  • Antibiotic resistance: Lipoproteins mediate interactions with host cells and drug efflux systems .

4.1. Genetic and Biochemical Studies

  • Lateral Gene Transfer (LGT) Models: While Lgt itself is not directly implicated in LGT mechanisms, recombinant Lgt facilitates studies on C. trachomatis membrane dynamics, which are relevant to LGT efficiency .

  • Antibiotic Resistance: Used to investigate mutations in lipid-modified proteins linked to drug resistance .

4.2. Immunoassays

  • Antigen Production: Recombinant Lgt serves as an antigen in ELISA for antibody detection in chlamydial infections .

Key Research Findings

Study FocusInsightsCitation
LGT FrequencyC. trachomatis exhibits LGT frequencies of 10⁻⁴–10⁻³ in vitro, enabling chromosomal recombination .
Recombination HotspotsCross-species LGT targets conserved regions like replication terminators .
Evolutionary ImpactLGT drives genomic mosaicism in C. trachomatis lineages, affecting virulence .

Challenges and Future Directions

  • Structural Studies: No resolved 3D structure of Lgt exists; cryo-EM or crystallography could elucidate substrate-binding mechanisms.

  • In Vivo Models: Testing recombinant Lgt in animal models to assess its role in infection persistence.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; CT_252; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
lgt
Target Protein Sequence
MIHWDQSRTLLSFPRVGLHLSWYGILFSLGIFLSSFSGIKLATALCKDREEKKELRTSLE NFALGALLAIIIGARLAYVLFYGGSFYFENPSEIIKIWKGGLSSHGAVISVVIWAAVFSR LHIRKLPMLSVTYICDLCGAVFGCAALLIRVGNFMNQEILGTPTSMPWGVIFPNGGGQIP RHPVQLYEGLGYLVLSCILYRLCYRGVIRLGSGYSAAGALIGVAVIRFCAEFFKTHQGAW LGEENILTIGQWLSIPMIFLGVGIIWIASKKK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.
Database Links

KEGG: ctr:CT_252

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is prolipoprotein diacylglyceryl transferase (Lgt) and what is its function in bacterial systems?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of bacterial lipoproteins. The enzyme specifically converts preprolipoproteins to prolipoproteins by adding a diacylglyceryl group to the sulfhydryl side chain of the invariant Cys+1 residue . This modification is essential for bacterial survival, particularly in Gram-negative bacteria where deletion of the lgt gene is often lethal .

In the bacterial lipoprotein biogenesis pathway, preprolipoproteins are first transported through the cytoplasmic membrane via the Sec or Tat translocon. As they exit the transport machinery, Lgt recognizes these proteins and transfers a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue. This lipid modification anchors the proteins to the membrane and is crucial for maintaining cell envelope architecture and various cellular functions .

What is known about lateral gene transfer (LGT) in Chlamydia trachomatis?

Key findings include:

  • Intraspecies DNA exchange occurs frequently and can cross species barriers between closely related chlamydiae, such as between C. trachomatis, C. muridarum, and C. suis

  • Whole-genome sequencing has uncovered clear evidence for LGT in the evolution of the Chlamydiaceae family

  • LGT events have been detected both within and among the four major strain clusters of C. trachomatis (lymphogranuloma venereum, trachoma, and two urogenital clusters)

  • The high frequency of between-strain genetic recombinants among clinical isolates suggests that LGT is an important means by which C. trachomatis generates variants with enhanced fitness

  • The acquisition of tetracycline resistance in C. suis represents the only recent instance of interphylum LGT in Chlamydia

What experimental systems have been developed to study LGT in C. trachomatis?

Several experimental systems have been developed to study LGT in C. trachomatis, with the most significant being in vitro co-infection models using antibiotic-resistant strains. The fundamental approach involves:

  • Simultaneous infection of host cells with different antibiotic-resistant strains of C. trachomatis

  • Development in the absence of antibiotics

  • Selection for doubly resistant recombinants in the progeny

For example, DeMars et al. first cultured different antibiotic-resistant D (rifampin) and L1 (ofloxacin) strains of C. trachomatis to produce recombinant progeny that were doubly resistant when grown in media containing both antibiotics . This system has been further developed and used to study various aspects of LGT in C. trachomatis, including:

  • Mapping genetic crossovers between strains

  • Determining the length of transferred DNA segments

  • Comparing in vitro recombinants with naturally occurring clinical recombinants

These experimental systems detect apparent recombinant frequencies of 10^-4 to 10^-3, which is approximately 10,000 times more frequent than doubly resistant spontaneous mutants in progeny from uniparental control infections .

How are recombinant C. trachomatis strains generated in laboratory settings?

Generating recombinant C. trachomatis strains in laboratory settings involves a specific methodology:

  • Selection of parental strains: Researchers typically use antibiotic-resistant mutants of different C. trachomatis strains. For example, an ofloxacin-resistant (Ofx^r) mutant of serovar L1 strain (L1:Ofx^r-1) and a rifampin-resistant (Rif^r) mutant of serovar D strain (D:Rif^r-1) .

  • Co-infection process: Host cells (typically HeLa cells) are simultaneously infected with both parental strains at specific multiplicities of infection.

  • Development without selection pressure: The infection is allowed to progress in the absence of antibiotics to permit natural recombination events.

  • Selection of recombinants: Progeny are then harvested and subjected to selection for doubly resistant recombinants by growth in media containing both antibiotics .

  • Clonal isolation: Individual recombinant clones can be isolated through limiting dilution or plaque purification methods.

This approach yields recombinant frequencies of approximately 10^-4 to 10^-3, which is significantly higher than the frequency of doubly resistant spontaneous mutants (approximately 10^-8) . The recombinants can then be characterized through DNA sequencing to map genetic crossovers and determine the parental sources of DNA segments .

What techniques are used to identify and characterize mixed infections of C. trachomatis?

Several advanced techniques are employed to identify and characterize mixed infections of C. trachomatis:

  • Next-generation high-throughput sequencing (NGHTS): This technique has been extensively used to detect mixed-genotype infections. Studies have shown that NGHTS can detect minor genotypes present at as low as 1% in a mixture .

    The process typically involves:

    • Nested-PCR amplification of target genes (often ompA)

    • Library preparation for high-throughput sequencing

    • Bioinformatic analysis to identify different genotypes and their proportions

  • Validation methods: To confirm mixed infections identified by NGHTS, researchers use:

    • Cloning of PCR products into E. coli followed by colony screening

    • Sanger sequencing of multiple clones

    • Comparison of genotyping results with reference sequences

  • Statistical analysis: Sophisticated statistical methods are employed to analyze the data, including:

    • Propensity score adjustment

    • Standardized mortality ratio weighting (SMRW)

    • Multivariate logistic regression to explore associations between mixed infections and clinical manifestations

The sensitivity and accuracy of NGHTS in distinguishing mixed C. trachomatis genotypes has been evaluated using plasmid DNA mixtures of different genotypes at various ratios. Results show excellent correlation between the prepared mixtures and NGHTS detection, with the ability to detect minor genotypes present at just 1% .

How do researchers determine the length of transferred DNA segments in LGT events?

Determining the length of transferred DNA segments in LGT events involves sophisticated genomic analysis techniques:

  • Whole-genome sequencing: Both parental and recombinant strains are sequenced to identify polymorphic nucleotide sites that differ between parental strains.

  • Mapping of crossover points: By comparing sequences of recombinants with parental strains, researchers identify regions where DNA sequence switches from one parental type to another, indicating genetic crossovers.

  • Calculation of minimum transfer length: The minimum length of transferred DNA is estimated as the distance between crossover points. Since recombination can involve multiple crossovers, researchers typically report the minimal length of transferred DNA .

In studies of C. trachomatis recombinants, the estimated minimal length of transferred DNA was ≥123 kb in one recombinant but ranged from ≥336 to ≥790 kb in others . These estimates depend on the assumed DNA donor, as it's not always possible to unequivocally identify which parental strain was the donor versus the recipient.

The length of transferred DNA segments provides valuable clues about the mechanism of LGT. For example, transfer of large DNA segments (hundreds of kilobases) has traditionally been associated with conjugation in known microbial LGT systems, although natural DNA transformation remains a conceivable mechanism in C. trachomatis .

What are the key differences between in vitro and naturally occurring clinical recombinants of C. trachomatis?

Research comparing in vitro and clinical recombinants has revealed several significant differences:

  • Breakpoint distribution: Using statistical analysis of breakpoint data, in vitro and clinical isolates cluster perfectly into two distinct groups without misclassification .

  • Selection pressures: In vitro recombinants show different selection patterns at specific loci:

    • Antibiotic resistance genes: As expected, gyrA (conferring ofloxacin resistance) and rpoB (conferring rifampin resistance) have significantly more breakpoints among in vitro recombinants than among clinical recombinants (p < 0.0001 and p = 0.02, respectively) .

    • Unexpected loci: Surprisingly, genes not directly related to antibiotic resistance also show different patterns. For example, trpA has significantly more breakpoints in in vitro recombinants (p < 0.0001), and there is strong bias for ompA in strain D (p = 3.3 × 10^-8) .

  • Recombination mechanisms: While the exact mechanisms remain unclear, the similar breakpoint regions flanking certain genes (like ompA) among both in vitro and clinical recombinants suggest common LGT mechanisms, despite different selection pressures .

This table summarizes the statistical differences in breakpoint frequency at key loci:

GeneFunctionIn vitro recombinantsClinical recombinantsStatistical significance
gyrAOfloxacin resistanceHigher frequencyLower frequencyp < 0.0001
rpoBRifampin resistanceHigher frequencyLower frequencyp = 0.02
trpATryptophan synthesisHigher frequencyLower frequencyp < 0.0001
ompAMajor outer membrane proteinStrong bias for strain DMore diverse patternsp = 3.3 × 10^-8

These findings indicate that while in vitro models are valuable for studying LGT mechanisms, they do not perfectly reflect natural recombination events .

What molecular mechanisms are thought to underlie LGT in C. trachomatis?

The exact molecular mechanisms underlying LGT in C. trachomatis remain incompletely understood, but several hypotheses have emerged:

The elucidation of these mechanisms is critical for developing genetic tools for C. trachomatis and understanding its evolution, but significant knowledge gaps remain and warrant further investigation.

What are the implications of recombination hotspots in the C. trachomatis genome?

Recombination hotspots in the C. trachomatis genome have significant implications for both evolutionary biology and biotechnology:

  • Evolutionary implications:

    • LGT events have been detected both within and among the four major strain clusters of C. trachomatis (lymphogranuloma venereum, trachoma, and two urogenital clusters)

    • These events have clinical impact in terms of virulence and epidemiology

    • Recombination can vary greatly between different lineages of C. trachomatis

    • Recombination helps overcome Muller's ratchet (the accumulation of deleterious mutations in asexual populations), which is crucial for chlamydial survival despite their intracellular lifestyle

  • Structural and functional significance:

    • Some studies have identified "hot spots" for recombination that flank important genes like ompA

    • The ompA gene encodes the major outer membrane protein, which is immunologically significant

    • Selection at the trpA locus might confer advantages related to tryptophan metabolism, which is crucial for surviving host defense mechanisms involving interferon-gamma-induced tryptophan depletion

  • Applications for genetic manipulation:

    • Understanding recombination hotspots could help design more efficient genetic manipulation strategies

    • These hotspots might serve as insertion sites for foreign DNA in future genetic engineering attempts

    • They could be utilized to develop a robust gene transfer system for C. trachomatis

  • Clinical relevance:

    • Certain recombination patterns might be associated with specific clinical presentations

    • For example, studies have shown that mixed-genotype infections are associated with severe vaginal cleanliness (degree IV) with an adjusted OR of 5.17 (95% CI 1.03-25.9, p = 0.046)

    • Mixed-genotype infections with large proportions of minor genotypes are associated with cervical squamous intraepithelial lesion (SIL) with an adjusted OR of 5.51 (95% CI 1.17-26.01, p = 0.031)

Understanding these hotspots and their implications remains a critical area of research with potential implications for both fundamental science and clinical applications.

How can the Lgt enzyme be manipulated to study lipoprotein processing in C. trachomatis?

Manipulation of the Lgt enzyme to study lipoprotein processing in C. trachomatis requires sophisticated approaches based on structural and functional insights:

  • Structure-guided mutagenesis: Based on crystal structures of related Lgt enzymes (such as E. coli Lgt solved at 1.9 Å resolution) , key residues can be targeted for mutagenesis:

    • Conserved residues identified as essential for function include:

      • Y26, N146, and G154 are absolutely required for Lgt function

      • R143, E151, R239, and E243 are important but not essential

    • The Lgt signature motif with its invariant residues is particularly significant as it faces the periplasm

  • Complementation assays: Functional studies can be performed using complementation assays:

    • Cysteine and alanine mutants of Lgt can be tested for their ability to complement Lgt depletion strains

    • Growth restoration in conditional knockout systems can quantify the impact of specific mutations

  • In vitro enzymatic assays: Direct measurement of Lgt activity can be performed using:

    • Synthetic peptide-substrates (e.g., MKATKSAVGSTLAGCSSHHHHHH) to test substrate preferences

    • Paper electrophoretic assays, which provide direct, more accurate, and precise measurements of enzyme activity

  • Membrane association studies: Understanding Lgt's interaction with the membrane:

    • Solubilization experiments reveal that Lgt has a peripheral and possibly reversible hydrophobic association with the inner membrane on the cytosolic side

    • This contradicts its deduced transmembrane topology but suggests that the committed first step of bacterial lipid modification may be aqueous compatible

    • Substitution of cysteine residues at various positions followed by accessibility studies can map the membrane topology

  • Application to C. trachomatis: Direct manipulation in C. trachomatis would likely require:

    • Adaptation of the in vitro LGT system to introduce modified Lgt variants

    • Development of selection systems for identifying transformants

    • Creation of reporter systems to monitor lipoprotein processing in vivo

These approaches could provide valuable insights into lipoprotein processing in C. trachomatis and potentially identify targets for therapeutic intervention.

What approaches can be used to develop a genetic manipulation system for C. trachomatis based on LGT mechanisms?

Developing a genetic manipulation system for C. trachomatis based on LGT mechanisms represents a significant challenge and opportunity. Several approaches can be considered:

  • Optimization of in vitro LGT systems:

    • Refine co-infection protocols to maximize recombination frequency

    • Identify conditions that promote DNA transfer between strains

    • Determine optimal multiplicities of infection and developmental timing for maximal recombination

  • Exploitation of recombination hotspots:

    • Target known recombination hotspots for introduction of foreign DNA

    • Design constructs with homology arms flanking these hotspots

    • Leverage areas with naturally high recombination frequencies, such as regions flanking ompA

  • Development of selection systems:

    • Create or identify additional antibiotic resistance markers suitable for C. trachomatis

    • Develop non-antibiotic selection systems (e.g., metabolic markers)

    • Implement counter-selection strategies to enrich for desired recombinants

  • Vector development:

    • Design specialized vectors incorporating chlamydial origins of replication

    • Include homology regions facilitating integration

    • Incorporate reporter genes for easy identification of transformants

  • Identification of DNA uptake mechanisms:

    • Determine whether natural DNA transformation occurs in C. trachomatis

    • Investigate the role of the RecBCD and RecFOR pathways in recombination

    • Characterize the exact machinery of DNA uptake and homologous recombination

  • Exploration of alternative approaches:

    • Evaluate whether conjugation-like mechanisms can be exploited

    • Consider whether membrane fusion between infected cells might facilitate DNA transfer

    • Investigate the possibility of using membrane vesicles for DNA delivery

  • Integration with other emerging technologies:

    • Combine LGT approaches with CRISPR-Cas systems adapted for C. trachomatis

    • Develop hybrid methodologies incorporating elements of both natural recombination and engineered systems

    • Explore synthetic biology approaches to enhance recombination frequencies

The development of such a system would represent a significant breakthrough in chlamydial research, potentially enabling genetic studies that have been largely impossible due to the organism's obligate intracellular lifestyle and the current limitations in genetic manipulation tools.

What are the key limitations of current in vitro recombination systems for C. trachomatis?

Current in vitro recombination systems for C. trachomatis face several significant limitations:

  • Selection bias: The use of antibiotic selection creates artificial selection pressures:

    • Selection for resistance genes (gyrA, rpoB) inevitably biases recombination patterns

    • Studies show that in vitro and clinical recombinants cluster into distinct groups based on breakpoint patterns

    • Unexpected selection at loci not directly involved in resistance (e.g., trpA, ompA) complicates interpretation of results

  • Limited control over recombination events:

    • Researchers cannot currently target specific genomic regions for recombination

    • The process relies on spontaneous events with unpredictable outcomes

    • Inability to control the direction of gene transfer (which strain serves as donor vs. recipient)

  • Technical challenges:

    • Labor-intensive process requiring specialized facilities for chlamydial culture

    • Limited efficiency, with recombination frequencies of only 10^-4 to 10^-3

    • Difficulty in obtaining pure recombinant populations without extensive clonal isolation

  • Incomplete understanding of mechanisms:

    • The exact machinery of DNA uptake and homologous recombination remains unclear

    • Uncertainty about whether the observed in vitro recombination reflects natural processes

    • Difficulty in distinguishing between different potential mechanisms (transformation vs. conjugation-like processes)

  • Limited genetic tools:

    • Few selectable markers available for C. trachomatis

    • Lack of complementary technologies (such as efficient plasmid transformation)

    • Absence of inducible expression systems to control gene expression

These limitations highlight the need for continued refinement of experimental systems and the development of alternative approaches for genetic manipulation of C. trachomatis.

How can researchers address the methodological challenges in studying the structure-function relationship of Lgt in C. trachomatis?

Studying the structure-function relationship of Lgt in C. trachomatis presents unique challenges that require innovative methodological approaches:

  • Heterologous expression systems:

    • Express C. trachomatis Lgt in more genetically tractable organisms (E. coli, Corynebacterium)

    • Utilize complementation assays in Lgt depletion strains to assess functionality

    • Compare with Lgt from model organisms where crystal structures are available (e.g., E. coli Lgt)

  • Structural prediction and modeling:

    • Use the 1.9 Å resolution crystal structure of E. coli Lgt as a template for homology modeling

    • Apply computational approaches to predict substrate binding sites and catalytic residues

    • Perform molecular dynamics simulations to understand substrate interactions

  • Targeted mutagenesis approaches:

    • Focus on highly conserved residues identified across bacterial species:

      • Target the Lgt signature motif with its invariant residues

      • Investigate Y26, N146, G154, R143, E151, R239, and E243, which have been shown to be important for function in related systems

    • Create alanine scanning libraries to systematically assess the importance of each residue

  • Functional assays:

    • Develop in vitro assays using synthetic peptide substrates

    • Adapt paper electrophoretic assays that provide direct measurement of enzyme activity

    • Create reporter systems to monitor lipoprotein processing in live bacteria

  • Integration with recombination systems:

    • Use the in vitro LGT system to introduce variant Lgt genes

    • Develop selection systems to identify functional variants

    • Create chimeric enzymes between C. trachomatis and related species to map functional domains

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to visualize Lgt localization

    • Use fluorescently labeled substrates to track enzyme activity in situ

    • Implement FRET-based assays to monitor protein-protein interactions

  • Cross-disciplinary approaches:

    • Combine structural biology, enzymology, and genetics

    • Leverage comparative genomics to identify conserved features across diverse bacterial species

    • Integrate systems biology approaches to understand the role of Lgt in the broader context of lipoprotein processing

By combining these approaches, researchers can overcome the inherent difficulties of studying proteins in the genetically challenging C. trachomatis system.

How do immunological factors affect the study of recombinant C. trachomatis strains?

Immunological factors significantly impact the study of recombinant C. trachomatis strains, creating both challenges and opportunities for researchers:

  • Compartmentalization of immune responses:

    • The female genital tract shows distinct immunological compartmentalization:

      • The upper genital tract (UGT) is dominated by Th1 responses with high IFN-γ and T-bet expression

      • The lower genital tract (LGT) shows predominance of IL-10 and GATA-3, suggesting Th2 responses

    • This compartmentalization affects the selection pressures on recombinant strains in different anatomical locations

  • Impact on tryptophan metabolism genes:

    • IFN-γ induces indoleamine 2,3-dioxygenase expression that degrades tryptophan, creating a defense mechanism

    • Recombination at the trpA locus may confer advantages in IFN-γ-rich environments

    • LGV strains (including L1) are less affected by IFN-γ, likely linked to polymorphisms at residues 177 and 178 in TrpA

    • In vitro recombinants frequently show L1-derived sequences in the C-terminal half of TrpA, suggesting selection advantage

  • Selection pressure on membrane proteins:

    • Strong bias for strain D ompA in in vitro recombinants (p = 3.3 × 10^-8)

    • ompA encodes the major outer membrane protein, a primary target for host immune responses

    • Recombination at this locus may affect antigenic variation and immune evasion

  • Experimental considerations:

    • Cell culture systems lack the complex immune environment of in vivo infections

    • In vitro systems may not reflect the selection pressures imposed by compartmentalized immune responses

    • Addition of cytokines (e.g., IFN-γ) to culture systems may help mimic physiological conditions

  • Clinical implications:

    • Mixed-genotype infections show associations with clinical manifestations:

      • Severe vaginal cleanliness (degree IV): adjusted OR of 5.17 (95% CI 1.03-25.9, p = 0.046)

      • Cervical squamous intraepithelial lesion (SIL): adjusted OR of 5.51 (95% CI 1.17-26.01, p = 0.031)

    • These associations suggest immune-mediated selection pressures on different genotypes and recombinants

Understanding these immunological factors is essential for interpreting results from recombination studies and for developing more physiologically relevant experimental systems.

What are the most promising avenues for developing a reliable gene transfer system for C. trachomatis?

Several promising avenues exist for developing a reliable gene transfer system for C. trachomatis:

  • Refinement of natural LGT systems:

    • Optimize co-infection protocols to maximize recombination frequency

    • Characterize the molecular machinery involved in DNA uptake and recombination

    • Target recombination hotspots identified in both in vitro and clinical recombinants

  • Development of transformation protocols:

    • Investigate conditions that might promote natural DNA transformation in C. trachomatis

    • Explore chemical treatments that increase membrane permeability

    • Develop electroporation protocols adapted for the unique biology of chlamydiae

  • CRISPR-Cas9 adaptation:

    • Engineer CRISPR-Cas9 systems optimized for C. trachomatis

    • Deliver components via modified LGT systems

    • Combine with homology-directed repair to achieve precise genetic modifications

  • Exploitation of membrane biology:

    • Investigate whether membrane fusion events during co-infection facilitate DNA transfer

    • Develop artificial membrane vesicles for DNA delivery

    • Explore the peripheral association of certain enzymes (like Lgt) with the membrane as potential entry points

  • Creation of shuttle vectors:

    • Design specialized vectors incorporating chlamydial origins of replication

    • Include selection markers functional in C. trachomatis

    • Incorporate recombination hotspots to facilitate integration

  • Transposon-based approaches:

    • Adapt transposon mutagenesis systems for C. trachomatis

    • Develop inducible transposase expression systems

    • Create transposon libraries for functional genomics studies

  • Synthetic biology approaches:

    • Engineer minimal genetic systems for introduction into C. trachomatis

    • Design synthetic regulatory circuits that function in the chlamydial intracellular environment

    • Create orthogonal genetic systems that minimize interference with host functions

The most successful approach will likely combine elements from multiple strategies, building on the extensive knowledge gained from in vitro LGT studies while incorporating new technologies from the rapidly evolving field of synthetic biology.

How might comparative genomics of clinical and laboratory recombinants inform the development of genetic tools?

Comparative genomics of clinical and laboratory recombinants offers valuable insights that could accelerate the development of genetic tools for C. trachomatis:

  • Identification of natural recombination hotspots:

    • Analysis of clinical recombinants has revealed specific regions with higher recombination frequencies

    • These hotspots could serve as preferred integration sites for genetic constructs

    • Sequences flanking ompA have been identified as recombination hotspots and could be incorporated into vector designs

  • Understanding selection mechanisms:

    • Comparing in vitro and clinical recombinants reveals different selection pressures:

      • Laboratory recombinants show selection at antibiotic resistance loci (gyrA, rpoB)

      • Unexpected selection at trpA and ompA in laboratory recombinants suggests complex fitness landscapes

    • These insights can inform the design of selection systems for genetic manipulation

  • Characterization of recombination machinery:

    • Sequence analysis of recombination junctions can reveal signature patterns

    • These patterns might indicate the involvement of specific DNA repair and recombination systems (RecBCD, RecFOR)

    • Understanding the molecular machinery facilitates targeted interventions to enhance recombination

  • Mapping transfer DNA lengths:

    • Studies show transferred DNA segments of ≥336 to ≥790 kb in most recombinants

    • This suggests potential mechanisms (conjugation-like vs. transformation)

    • Knowledge of typical transfer lengths informs the design of genetic constructs

  • Strain-specific variations:

    • Different C. trachomatis strains show varying recombination propensities

    • Understanding strain-specific factors could help select optimal backgrounds for genetic manipulation

    • Identifying strains with naturally higher recombination frequencies could facilitate tool development

  • Cross-species insights:

    • Comparison with recombination in related species (C. muridarum, C. suis)

    • Studies show that intraspecies crosses generally lead to higher proportions of donor DNA in recombinants

    • This knowledge helps optimize experimental designs for different genetic manipulation goals

  • Functional analysis of recombinants:

    • Phenotypic characterization of recombinants with specific genetic compositions

    • Correlation of genetic variation with functional outcomes

    • Identification of genetic elements that enhance or inhibit recombination

By systematically analyzing and comparing clinical and laboratory recombinants, researchers can identify key genetic elements, optimal experimental conditions, and promising target sites for developing efficient genetic manipulation tools for C. trachomatis.

What are the potential applications of engineered recombinant C. trachomatis strains in vaccine development?

Engineered recombinant C. trachomatis strains offer promising opportunities for vaccine development:

  • Attenuation strategies:

    • Generate recombinants with targeted deletions in virulence factors

    • Create strains with modified lipid biosynthesis (via Lgt manipulation) that maintain immunogenicity but reduce pathogenicity

    • Develop temperature-sensitive mutants that cannot replicate at body temperature

  • Enhanced immunogenicity:

    • Engineer strains expressing multiple variants of immunodominant antigens

    • Modify ompA sequences to create chimeric major outer membrane proteins that provide broader protection

    • Incorporate sequences from different serovars to generate cross-protective immunity

  • Immune modulation:

    • Design recombinants that preferentially stimulate Th1 responses, which are critical for protection

    • Reduce IL-10 induction to prevent the establishment of immunologically privileged sites

    • Modify strains to bypass the compartmentalized immune response in the genital tract

  • Targeted antigen delivery:

    • Use lipoprotein processing systems (involving Lgt) to display foreign antigens

    • Create recombinants that express heterologous antigens from other pathogens

    • Develop multi-valent vaccine candidates expressing antigens from multiple serovars

  • Safety enhancements:

    • Generate auxotrophic strains that cannot complete development in vivo

    • Create strains with inducible growth requirements that limit dissemination

    • Develop recombinants with enhanced sensitivity to antibiotics as a safety mechanism

  • Experimental vaccines for preclinical testing:

    • Use recombination to create libraries of strains with varying immunogenic properties

    • Evaluate different combinations of antigens for protective efficacy

    • Identify optimal strain backgrounds for vaccine development

  • Practical considerations:

    • Leverage the natural persistence of C. trachomatis for sustained immune stimulation

    • Utilize the obligate intracellular lifestyle to target specific immune processing pathways

    • Exploit the tropism for mucosal surfaces to enhance mucosal immunity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.