Recombinant Chlamydia trachomatis Putative zinc metalloprotease CT_072 (CT_072)

What is CT_072 and what is its significance in Chlamydia trachomatis?

CT_072 is a full-length protein (619 amino acids) identified in Chlamydia trachomatis and classified as a putative zinc metalloprotease based on sequence analysis and structural predictions . The protein is encoded by the CT_072 gene and is assigned the UniProt identifier O84075. As a putative zinc metalloprotease, it likely plays a role in protein processing, degradation, or modification processes within the chlamydial developmental cycle . Understanding this protein's function is significant because proteases often serve as key regulators in bacterial pathogenesis, potentially affecting host-pathogen interactions, bacterial survival mechanisms, and infection progression.

How is recombinant CT_072 typically expressed for research purposes?

Recombinant CT_072 is commonly expressed in E. coli expression systems with an N-terminal His tag to facilitate purification . The full-length protein (amino acids 1-619) is expressed as a fusion protein, with the His tag enabling efficient purification through affinity chromatography. Following expression, the protein is typically purified and supplied as a lyophilized powder. For optimal use in research applications, it's recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol as a cryoprotectant for long-term storage at -20°C to -80°C .

What are the optimal storage conditions for recombinant CT_072 protein?

For optimal stability and activity preservation, recombinant CT_072 protein should be stored at -20°C to -80°C upon receipt . The protein is typically provided in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain structural integrity during freezing and thawing cycles. To minimize protein degradation, it's advisable to aliquot the reconstituted protein to avoid repeated freeze-thaw cycles, as these can compromise protein structure and function. Working aliquots can be stored at 4°C for up to one week . When longer storage is required, maintaining the protein in a buffer containing 50% glycerol at -20°C or -80°C is recommended.

What detection methods are available for confirming the presence of CT_072 in experimental samples?

Several methodological approaches can be employed to detect CT_072 in experimental samples, leveraging techniques used for C. trachomatis detection more broadly. Western blotting using antibodies specific to CT_072 or to the His tag is a primary method for detection and quantification in recombinant protein studies . For detecting native expression in C. trachomatis, quantitative PCR targeting the CT_072 gene provides a sensitive approach for measuring gene expression levels . Additionally, mass spectrometry can be used for both identification and characterization of CT_072 in complex samples. Immunofluorescence microscopy using fluorescently labeled antibodies can also localize the protein within bacterial or host cells, particularly when examining the protein's distribution during different stages of the chlamydial developmental cycle .

How does the zinc metalloprotease activity of CT_072 potentially influence C. trachomatis pathogenesis?

As a putative zinc metalloprotease, CT_072 likely contributes to C. trachomatis pathogenesis through several potential mechanisms that merit investigation. Zinc metalloproteases typically function by cleaving peptide bonds using a zinc ion in their active site, which could enable CT_072 to modify host cell proteins, facilitating bacterial invasion, immune evasion, or intracellular survival . The protein's predicted membrane localization (based on its amino acid sequence containing transmembrane domains: MTIIYFVLAALALGFLILIHELGHLLAAKAVGM) suggests it may participate in host-pathogen interface interactions. Experimental approaches to investigate CT_072's role in pathogenesis include gene knockout or knockdown studies followed by infection assays to measure effects on bacterial invasion, replication, and host cell responses. Similar to studies with DksA described in the literature, examination of CT_072 expression during different stages of the developmental cycle would provide insights into its temporal significance .

What structural and functional domains characterize CT_072, and how do they compare to other bacterial zinc metalloproteases?

Analysis of CT_072's amino acid sequence (619 amino acids) reveals several key structural features typical of zinc metalloproteases . The protein contains predicted transmembrane regions (particularly in the N-terminal portion), suggesting membrane association. Comparative structural analysis with other bacterial zinc metalloproteases would likely identify the conserved HExxH motif characteristic of the zinc-binding domain in metalloproteases, though the specific location should be confirmed experimentally.

The sequence MTIIYFVLAALALGFLILIHELGHLLAAKAVGMSVESFSIGFGPALVRKKMGSVEYRIGAIPFGGYVRIKGMDRNDKDNSGDKEKTVYDIPEGFFSKSPWKRIFVLAAGPLANLLVAIFVFGILYFSGGRTKSFSEYTSIVGWVHPSLEQQGLHAGDQIFFCNGQPYSGHKMAFSSSLLER suggests an N-terminal signal peptide consistent with the protein's predicted secretory or membrane-associated function.

What experimental approaches are most effective for analyzing the enzymatic activity of recombinant CT_072?

To effectively analyze the enzymatic activity of recombinant CT_072 as a putative zinc metalloprotease, researchers should consider a multi-faceted approach:

• Substrate specificity assays: Using fluorogenic peptide substrates with different cleavage sites to determine the enzyme's preferred substrate profile.

• Inhibitor studies: Employing metal chelators (such as EDTA or 1,10-phenanthroline) to confirm zinc dependence, and testing against known metalloprotease inhibitors.

• Enzyme kinetics: Determining KM, Vmax, and kcat values under varying conditions of pH, temperature, and salt concentration to establish optimal reaction parameters.

• Zymography: Conducting gel-based assays with incorporated protein substrates to visualize proteolytic activity bands.

• Mass spectrometry: Identifying cleavage products to map precise cutting sites on substrate proteins.

Enzyme assays should be conducted with purified recombinant CT_072 reconstituted according to the manufacturer's recommendations (0.1-1.0 mg/mL in deionized water) . Activity measurements should include appropriate controls, including heat-inactivated enzyme and reactions in the presence of specific inhibitors to confirm specificity.

How might mutations in the CT_072 gene affect C. trachomatis virulence and antibiotic susceptibility?

Mutations in the CT_072 gene could potentially impact C. trachomatis virulence and antibiotic susceptibility through several mechanisms. If CT_072 is involved in bacterial cell wall remodeling or membrane integrity (consistent with its predicted membrane association) , mutations could alter cell envelope properties, potentially affecting antibiotic penetration and efficacy. Changes in proteolytic activity might disrupt normal developmental cycling, potentially altering the timing of transition between elementary bodies (EBs) and reticulate bodies (RBs), which could impact both virulence and treatment response .

Experimental approaches to investigate these effects would include:

• Site-directed mutagenesis of key residues (particularly within the predicted catalytic domain)

• Expression of mutant variants in C. trachomatis using transformation techniques described for other chlamydial genes

• Assessment of developmental cycle progression, infectious progeny production (measured via inclusion-forming unit assays), and antibiotic susceptibility testing with various classes of antibiotics

These experiments would help establish if CT_072 represents a potential target for novel therapeutic approaches against C. trachomatis infections.

What cell culture systems are optimal for studying CT_072 in the context of C. trachomatis infection?

For studying CT_072 in the context of C. trachomatis infection, researchers typically employ established cell culture systems optimized for chlamydial growth and development. The literature indicates that HeLa cells (human cervix adenocarcinoma) and McCoy cells (murine fibroblasts) are the most commonly used and well-characterized host cell lines for C. trachomatis studies . These cells should be maintained at 37°C with 5% CO2 in appropriate media such as RPMI 1640 supplemented with 10% FetalPlex serum complex and antibiotics (e.g., 10 μg/mL Gentamicin) .

For infection studies, C. trachomatis elementary bodies (EBs) should be purified by density gradient centrifugation and stored at -80°C in sucrose-phosphate-glutamate or K36 buffer until use . Infection protocols typically involve:

• Seeding cells at appropriate density 24 hours before infection

• Infecting with purified EBs at a predetermined multiplicity of infection

• Centrifuging cultures (e.g., 900 × g for 1 hour) to enhance infection efficiency

• Incubating infected cultures and harvesting at appropriate time points based on the developmental cycle stage of interest

When specifically studying CT_072, researchers might employ inducible expression systems similar to those described for DksA, allowing for controlled expression at different stages of the developmental cycle .

What purification strategies yield the highest purity and activity for recombinant CT_072?

Purifying recombinant CT_072 to high purity while maintaining enzymatic activity requires careful consideration of expression and purification conditions. Since the commercially available recombinant protein is His-tagged and expressed in E. coli , the following optimized purification strategy is recommended:

• Bacterial expression: Utilize E. coli strains optimized for recombinant protein expression (BL21(DE3), Rosetta, or similar) with induction conditions optimized for soluble protein yield.

• Lysis buffer selection: Use a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and a protease inhibitor cocktail without metal chelators (which could interfere with the zinc-binding site).

• Initial purification: Employ immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin to capture the His-tagged protein.

• Secondary purification: Apply size exclusion chromatography to remove aggregates and further purify the protein.

• Quality control: Confirm purity via SDS-PAGE (>90% purity is typically achievable) and verify identity by western blotting or mass spectrometry.

• Activity preservation: Store in a stabilizing buffer containing 50% glycerol at -80°C, with aliquoting to avoid freeze-thaw cycles .

For zinc metalloproteases, it's crucial to ensure that the purified protein retains its zinc cofactor, which may require supplementation of trace amounts of zinc during purification or a final dialysis step into a buffer containing appropriate zinc concentration.

How can researchers effectively detect and quantify CT_072 expression during different stages of the C. trachomatis developmental cycle?

Detecting and quantifying CT_072 expression throughout the C. trachomatis developmental cycle requires a combination of molecular and protein-based techniques. Based on methodologies employed for similar chlamydial proteins , the following approach is recommended:

• Transcriptional analysis:

  • Perform quantitative reverse transcription PCR (RT-qPCR) targeting CT_072 mRNA at various time points post-infection.

  • Design primers specific to CT_072 gene regions with minimal homology to host genes.

  • Normalize expression to stable chlamydial reference genes.

• Protein detection:

  • Develop western blot protocols using antibodies specific to CT_072.

  • Perform immunofluorescence microscopy to visualize protein localization within inclusions.

  • Consider developing a specific ELISA for high-throughput quantification.

• Temporal sampling strategy:

  • Collect samples at key developmental time points (typically 0, 6, 12, 24, 36, and 48 hours post-infection).

  • Separate EBs and RBs using density gradient centrifugation to determine form-specific expression.

• Inducible expression systems:

  • Implement theophylline-inducible RNA-based expression systems similar to those described for DksA to manipulate CT_072 expression .

  • Measure effects on bacterial replication by genome equivalent (GE) quantification and inclusion-forming unit (IFU) assays.

This multi-faceted approach enables comprehensive characterization of CT_072 expression patterns and their correlation with specific stages of the developmental cycle.

What are the most sensitive methods for detecting CT_072 in clinical samples?

While CT_072 itself is not typically the target for clinical diagnostics, the detection principles used for C. trachomatis provide valuable insights for developing CT_072-specific detection methods in research contexts. Based on current diagnostic approaches , the most sensitive methods would include:

• Nucleic Acid Amplification Tests (NAATs):

  • Real-time PCR targeting CT_072 gene sequences provides high sensitivity and specificity.

  • Transcription-mediated amplification (TMA) targeting CT_072 mRNA can detect metabolically active organisms.

  • Digital PCR offers absolute quantification with potentially higher sensitivity than traditional qPCR.

• Protein-Based Detection:

  • Immunoassays using monoclonal antibodies specific to CT_072 can be developed for research purposes.

  • Mass spectrometry-based proteomics can identify CT_072-specific peptides in complex samples.

• Sample Processing Considerations:

  • Optimal sample collection and processing are critical for maintaining sensitivity.

  • For research involving clinical samples, nucleic acid extraction methods should be optimized for bacterial DNA/RNA recovery.

When developing CT_072-specific detection methods, researchers should be aware of the limitations observed with commercial C. trachomatis assays, such as the false-negative results reported with certain platforms targeting specific rRNA regions . This highlights the importance of careful target selection when designing CT_072-specific detection assays.

How can researchers troubleshoot expression and purification issues with recombinant CT_072?

Researchers encountering difficulties with recombinant CT_072 expression and purification should consider this systematic troubleshooting approach:

Expression Issues:

• Low expression levels:

  • Optimize codon usage for E. coli

  • Test different E. coli strains (BL21, Rosetta, etc.)

  • Vary induction conditions (temperature, IPTG concentration, induction time)

  • Consider using stronger promoters or high-copy-number plasmids

• Protein insolubility:

  • Lower induction temperature (16-20°C)

  • Reduce inducer concentration

  • Co-express with chaperones

  • Consider expressing as smaller functional domains rather than the full 619-amino acid protein

Purification Challenges:

• Poor binding to affinity resin:

  • Ensure the His-tag is accessible and not buried in protein structure

  • Optimize imidazole concentration in binding and wash buffers

  • Consider using denaturing conditions followed by refolding

• Impaired activity after purification:

  • Verify zinc incorporation using atomic absorption spectroscopy

  • Supplement purification buffers with low concentrations of zinc

  • Test different buffer compositions and pH values

  • Include stabilizing agents like trehalose (6%) in storage buffer

• Protein degradation:

  • Include protease inhibitors throughout purification

  • Maintain samples at 4°C during processing

  • Aliquot and store at -80°C to avoid freeze-thaw cycles

By systematically addressing these common issues, researchers can optimize conditions for successful recombinant CT_072 production and purification.

What statistical approaches are most appropriate for analyzing CT_072 activity data in comparative studies?

When analyzing experimental data related to CT_072 activity in comparative studies, researchers should employ rigorous statistical approaches tailored to the specific experimental design. Based on methods used in similar protease and chlamydial research , the following statistical framework is recommended:

For enzyme kinetic studies:

• Non-linear regression analysis for determining enzyme kinetic parameters (KM, Vmax)

• Comparison of kinetic parameters across different conditions using one-way ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's)

• Calculation of inhibition constants (Ki) using appropriate inhibition models (competitive, non-competitive, or mixed)

For infection studies:

• Statistical comparison of genome equivalents (GE) and inclusion-forming units (IFU) between experimental groups using appropriate t-tests or ANOVA with post-hoc analysis

• Calculation of percentage reductions in bacterial replication or infectious progeny production relative to controls

• When analyzing time-course data, consider repeated measures ANOVA or mixed-effects models

For all experimental data:

• Determine appropriate sample sizes through power analysis before experiments

• Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

• Consider non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when data do not meet assumptions for parametric tests

• Report confidence intervals (typically 95%) alongside p-values

• Control for multiple comparisons using methods such as Bonferroni correction or Benjamini-Hochberg procedure

Following these statistical guidelines will ensure robust analysis of CT_072 activity data, facilitating meaningful comparisons across experimental conditions and between different studies in the literature.

How might CT_072 serve as a potential target for novel therapeutic approaches against C. trachomatis infections?

As a putative zinc metalloprotease with predicted membrane association , CT_072 represents a promising target for novel therapeutic approaches against C. trachomatis infections. Several research directions could exploit this potential:

• Small molecule inhibitor development:

  • Structure-based drug design targeting the catalytic domain of CT_072

  • High-throughput screening of compound libraries against purified recombinant CT_072

  • Repurposing of existing metalloprotease inhibitors with optimization for CT_072 specificity

• Peptide-based inhibitors:

  • Design of competitive substrate analogs that bind the active site without being cleaved

  • Development of allosteric inhibitors targeting regulatory domains

• Antibody-based approaches:

  • Generation of neutralizing antibodies against surface-exposed regions of CT_072

  • Antibody-drug conjugates for targeted delivery of antimicrobial compounds

• Vaccination strategies:

  • Evaluation of recombinant CT_072 or its immunogenic epitopes as vaccine candidates

  • Assessment of protective immunity in animal models of chlamydial infection

The potential efficacy of such approaches would need to be validated through careful experimental designs, including:

• In vitro inhibition assays with purified CT_072

• Cell culture infection models measuring effects on bacterial entry, replication, and exit

• Animal models evaluating infection clearance and prevention of disease sequelae

Considering the challenges of false-negative results in current diagnostic assays , therapeutic approaches targeting CT_072 could potentially address infections that might be missed by standard detection methods.

What role might CT_072 play in host-pathogen interactions during C. trachomatis infection?

The predicted structural features and putative proteolytic activity of CT_072 suggest potential roles in host-pathogen interactions that merit investigation. As a zinc metalloprotease with predicted membrane association , CT_072 could participate in several critical aspects of C. trachomatis pathogenesis:

• Modulation of host immune responses:

  • Potential cleavage of host cytokines, chemokines, or their receptors

  • Processing of pathogen-associated molecular patterns (PAMPs) to evade recognition

  • Degradation of antimicrobial peptides produced by the host

• Facilitation of intracellular survival:

  • Modification of host proteins involved in vesicular trafficking

  • Alteration of inclusion membrane properties to prevent lysosomal fusion

  • Processing of bacterial proteins required for adaptation to the intracellular environment

• Contribution to bacterial exit and dissemination:

  • Degradation of host cytoskeletal components facilitating release

  • Processing of bacterial proteins involved in the transition from RBs to EBs

Experimental approaches to investigate these potential roles would include:

• Identification of host and bacterial substrates using proteomics approaches

• Localization studies using immunofluorescence microscopy at different infection stages

• Comparison of host cell responses to wild-type versus CT_072-deficient strains

• Assessment of infection outcomes in the presence of specific CT_072 inhibitors

Understanding CT_072's role in host-pathogen interactions could reveal new insights into chlamydial pathogenesis and identify novel intervention strategies.