Recombinant Chlamydia trachomatis serovar A Deubiquitinase and deneddylase Dub2 (cdu2)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

The cdu2 gene of Chlamydia trachomatis encodes ChlaDUB2, a specialized protein that functions as both a deubiquitinating and deneddylating enzyme. These dual enzymatic capabilities place ChlaDUB2 in a unique category of bacterial proteases. ChlaDUB2, along with its counterpart ChlaDUB1, represents the first identified bacterial deubiquitinating enzymes (DUBs) that possess both deubiquitinating and deneddylating functions . These enzymes belong to a class of proteases whose catalytic domains share structural similarities with eukaryotic ubiquitin-like proteases (Ulp) . This evolutionary convergence suggests an important role in the bacterial-host interaction dynamics during Chlamydia infection.

The distribution of the ChlaDUB2 enzyme is not uniform across all Chlamydia species. Genetic analyses have demonstrated that genes encoding both ChlaDUB1 and ChlaDUB2 are present across most Chlamydia species with a notable exception - they are absent in Chlamydia pneumoniae . This selective distribution pattern among Chlamydia species indicates potential specialization related to host tropism or infection strategies.

Enzymatic Activities and Substrate Specificity

ChlaDUB2 displays a complex profile of enzymatic capabilities with distinct substrate preferences. The enzyme exhibits both deubiquitinating and deneddylating activities, allowing it to process both ubiquitin and NEDD8 modifications from target proteins . This dual functionality is relatively rare, particularly in bacterial enzymes, making ChlaDUB2 a subject of significant research interest.

Deubiquitinating Activity

When presented with polyubiquitinated green fluorescent protein (GFP-Ubn) as a substrate, ChlaDUB2 shows a unique processing pattern. While it causes depletion of the substrate, it fails to produce appreciable levels of monoubiquitin products, unlike ChlaDUB1 which efficiently disassembles the polyubiquitin chains into monoubiquitin products . This functional divergence suggests specialized roles for these enzymes during Chlamydia infection.

Deneddylating Activity

Beyond its deubiquitinating function, ChlaDUB2 possesses deneddylating activity, enabling it to remove NEDD8 modifications from target proteins . The enzyme efficiently hydrolyzes neddylated substrates, confirming its functional versatility. This dual capability makes ChlaDUB2 particularly interesting from both evolutionary and functional perspectives, as it represents one of the first known bacterial enzymes with this dual activity profile .

Reactivity with Activity-Based Probes

Experimental evidence demonstrates that both ChlaDUB1 and ChlaDUB2 react with activity-based probes, providing a useful methodological approach for studying these enzymes . This reactivity confirms the active site accessibility and functionality of the recombinant forms of these enzymes, facilitating further biochemical and structural studies.

Comparative Analysis: ChlaDUB2 versus ChlaDUB1

While ChlaDUB1 and ChlaDUB2 were initially presumed to have redundant functions due to similarities in their catalytic domain structures, detailed biochemical and structural investigations have revealed significant functional differences between these two enzymes .

Functional Divergence

The distinct substrate processing profiles of ChlaDUB1 and ChlaDUB2 suggest specialized roles during Chlamydia infection rather than functional redundancy . ChlaDUB1 appears optimized for efficient breakdown of ubiquitin chains into monoubiquitin units, functioning similarly to the prokaryotic DUB SdeA in diubiquitin hydrolysis . In contrast, ChlaDUB2 seems to interact with ubiquitinated substrates differently, potentially targeting specific host proteins or structures during different infection phases.

Role in Chlamydia trachomatis Pathogenesis

The presence of specialized deubiquitinating enzymes in Chlamydia trachomatis highlights the importance of manipulating the host ubiquitin system during infection. As an obligate intracellular pathogen, Chlamydia has developed sophisticated mechanisms to exploit host cells for survival and replication . The deubiquitinating and deneddylating activities of ChlaDUB2 likely contribute to these processes in several ways.

Evasion of Host Defense Mechanisms

The ubiquitin system plays a crucial role in innate immune responses and cellular defense against pathogens. By expressing enzymes that can modify or reverse ubiquitination, Chlamydia may counteract host defense mechanisms, potentially including ubiquitin-mediated targeting of bacterial components for degradation or inflammatory signaling pathways regulated by ubiquitination .

Developmental Cycle Regulation

Chlamydia trachomatis undergoes a complex biphasic developmental cycle involving conversion between infectious elementary bodies (EBs) and replicative reticulate bodies (RBs) . The expression of deubiquitinating enzymes may contribute to regulating this developmental cycle by modifying host or bacterial proteins at specific stages of infection.

Methodology in ChlaDUB2 Research

Research on ChlaDUB2 has employed various experimental approaches to elucidate its structure and function. Key methodologies include:

Biochemical Activity Assays

The enzymatic properties of ChlaDUB2 have been characterized using various substrates, including:

  1. Ubiquitin aminomethylcoumarin (Ub-AMC) for measuring monoubiquitin cleavage activity

  2. Diubiquitin substrates for assessing chain processing capabilities

  3. Polyubiquitinated green fluorescent protein (GFP-Ubn) for evaluating complex substrate handling

  4. Activity-based probes for confirming functional activity

These assays have revealed the distinct substrate preferences and processing mechanisms of ChlaDUB2 compared to ChlaDUB1 and other deubiquitinating enzymes.

Research Significance and Future Directions

The discovery and characterization of ChlaDUB2 contribute significantly to our understanding of bacterial pathogenesis and host-pathogen interactions. As one of the first identified bacterial enzymes with dual deubiquitinating and deneddylating activities, ChlaDUB2 represents an important model for studying how bacterial pathogens manipulate host post-translational modification systems.

Therapeutic Potential

The structural and functional characterization of ChlaDUB2 provides potential targets for therapeutic intervention. Developing specific inhibitors against this enzyme could offer novel strategies for treating Chlamydia infections by disrupting the pathogen's ability to manipulate host cellular processes.

Areas for Future Investigation

Several questions remain regarding ChlaDUB2 function and regulation:

  1. The specific host targets of ChlaDUB2 during Chlamydia infection

  2. Temporal regulation of ChlaDUB2 expression during the developmental cycle

  3. Mechanisms by which ChlaDUB2 contributes to immune evasion

  4. Structural basis for the differential processing of polyubiquitinated substrates

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdu2; CTA_0947; Deubiquitinase and deneddylase Dub2; ChlaDub2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Target Names
cdu2
Target Protein Sequence
MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLL DADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPL TKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYNYIASPQQMREQLEGLA ASLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Uniprot No.

Target Background

Function
Effector proteins play a crucial role in modifying host cell physiology and promoting bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities.
Database Links

KEGG: cta:CTA_0947

Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Q&A

What is cdu2 and what are its primary functions in Chlamydia trachomatis pathogenesis?

Cdu2 (Chlamydia trachomatis Deubiquitinase and Deneddylase Dub2) is a protein identified in C. trachomatis that possesses both deubiquitinating and deneddylating enzymatic activities . These activities suggest that cdu2 likely plays a role in modulating host cell ubiquitination pathways during infection.

Ubiquitination and neddylation are post-translational modifications that regulate various cellular processes including protein degradation, cell cycle progression, and innate immune responses. By possessing deubiquitinase and deneddylase activities, cdu2 likely helps C. trachomatis evade host defense mechanisms and establish a favorable environment for bacterial replication.

C. trachomatis is an obligate intracellular pathogen that must manipulate host cell processes to survive and replicate. The pathogen multiplies exclusively inside host cells within a characteristic vacuole, from where it can manipulate host cells by injecting effector proteins . Although cdu2's exact role isn't fully characterized in the available research, its enzymatic functions suggest it may be one of these critical effector proteins that modifies host protein regulation.

What is known about the expression of cdu2 across different C. trachomatis serovars?

While specific comparative data on cdu2 expression across different serovars is limited in the provided research, we know that C. trachomatis serovars demonstrate significant biological differences despite high genomic similarity. The serovars are categorized based on their tissue tropism: serovars A-C cause ocular infections, D-K cause genital infections, and L1-L3 cause the invasive disease lymphogranuloma venereum .

Research indicates that different C. trachomatis serovars display distinct patterns of intracellular replication and inclusion development in various host cell types. For example, serovar A shows restricted replication in urogenital epithelial cells while demonstrating better growth in conjunctival epithelial cells . This serovar-specific behavior suggests that proteins like cdu2 may be differentially expressed or regulated across serovars to facilitate their adaptation to specific host tissues.

When studying cdu2 expression across serovars, researchers should consider these inherent biological differences and design comparative experiments that account for serovar-specific growth characteristics in different cell types.

How does serovar A differ from other C. trachomatis serovars in host cell interactions?

Serovar A, associated with ocular infections, demonstrates several distinctive characteristics in host cell interactions:

  • Restricted growth in urogenital cells: Research shows that urogenital epithelial cells (including vaginal, ectocervical, and foreskin cells) significantly restrict replication of serovar A while supporting robust growth of serovars D and L2 .

  • Inclusion development: Microscopy reveals that serovar A forms smaller, less developed inclusions in urogenital epithelial cells compared to other serovars .

  • Cytokine induction profile: Serovar A elicits a different pattern of inflammatory cytokine and chemokine production compared to serovars D and L2. For example, serovar A may induce different levels of GM-CSF, IL-8, and other inflammatory mediators in a cell-type specific manner .

  • Macrophage interactions: Serovar A shows severely impaired inclusion development in macrophages, with only a few individual bacteria observed 48 hours post-infection, suggesting this serovar cannot effectively replicate in phagocytic cells .

These differences highlight the specialized adaptation of serovar A to conjunctival epithelium and may reflect differential expression or activity of effector proteins, potentially including cdu2.

What experimental approaches are most effective for characterizing the enzymatic activity of recombinant cdu2?

Characterizing the enzymatic activity of recombinant cdu2 requires multiple complementary approaches:

When characterizing enzymatic activity, researchers should include appropriate controls, including catalytically inactive mutants of cdu2 (typically created by point mutations in the catalytic domain) to distinguish between specific enzymatic effects and non-specific protein interactions.

How might cdu2 contribute to the differential growth patterns observed between C. trachomatis serovars in various cell types?

The differential growth patterns of C. trachomatis serovars across cell types may be influenced by effector proteins like cdu2. Based on the research data, we can propose several mechanisms:

  • Modulation of host ubiquitination pathways: Different cell types exhibit varied ubiquitination landscapes. If cdu2 targets specific ubiquitinated host proteins, its effectiveness might vary between cell types, contributing to serovar-specific growth patterns.

  • Interference with innate immune signaling: Many innate immune pathways rely on ubiquitination for signal transduction. Research shows that different cell types produce distinct cytokine profiles in response to different C. trachomatis serovars . Cdu2 might contribute to these differences by selectively modulating immune signaling pathways.

  • Cell-type specific substrate availability: The effectiveness of cdu2 could depend on the abundance of its substrates, which may vary between conjunctival, urogenital, and phagocytic cells.

An experimental approach to investigate this question could involve:

  • Creating cdu2 knockout strains in different serovars

  • Comparing growth in various cell types (HCjE, HVEC, HFK-2, HCK, and macrophages)

  • Complementation studies with wild-type and mutant cdu2

  • Analysis of ubiquitination patterns in infected cells

This approach would help determine whether cdu2 contributes to the observed growth differences between serovars A, D, and L2 in different host cell types.

What methodologies can be employed to study the temporal expression of cdu2 during the developmental cycle of C. trachomatis?

Studying the temporal expression pattern of cdu2 during the developmental cycle requires techniques that can detect both transcription and translation with minimal disruption to the infection process:

  • RT-qPCR time course: Extracting RNA from infected cells at multiple time points (e.g., 2, 6, 12, 24, 36, and 48 hours post-infection) to quantify cdu2 transcript levels relative to housekeeping genes.

  • Immunofluorescence microscopy: Using antibodies against cdu2 or epitope-tagged versions (as demonstrated with CteG-2HA in the research) to visualize protein localization and abundance throughout the developmental cycle .

  • Western blot analysis: Quantifying cdu2 protein levels at different time points.

  • Reporter systems: Constructing strains where promoters of interest drive expression of fluorescent proteins to monitor transcriptional activity in real-time.

  • Translational reporters: Fusion of cdu2 with destabilized fluorescent proteins to monitor protein synthesis and turnover.

An effective experimental design would combine these approaches while considering:

  • The biphasic developmental cycle of C. trachomatis (elementary bodies to reticulate bodies and back)

  • The potential impact of host cell type on expression patterns

  • The need for synchronized infections to obtain clear temporal data

  • The possibility that protein function may be regulated post-translationally, independent of expression level

How does cytokine production in response to C. trachomatis serovar A infection relate to cdu2 activity?

Research indicates that C. trachomatis serovar A induces a specific cytokine production profile that differs from other serovars. While direct evidence linking cdu2 to cytokine production is not explicitly provided in the search results, we can identify potential relationships:

CytokineResponse to Serovar APotential Relationship to cdu2
GM-CSFProduced in HCK cellsMay be regulated by ubiquitination pathways that cdu2 could influence
RANTESDifferential productionKnown to be regulated by NF-κB, which is heavily regulated by ubiquitination
IL-1α/βProduced in response to serovar AInflammasome activation is regulated by ubiquitination
IL-8Potentially repressed by serovar AInhibition of IL-8 might involve cdu2-mediated deubiquitination of signaling proteins

Research data suggests that inhibition of serovar A protein synthesis with chloramphenicol resulted in production of IL-6 and IL-8, indicating that serovar A may actively repress these cytokines . This repression could potentially involve cdu2-mediated deubiquitination of key signaling proteins.

To investigate this relationship, researchers could:

  • Compare cytokine production between wild-type and cdu2-deficient strains

  • Examine ubiquitination status of key immune signaling proteins during infection

  • Perform complementation studies with catalytically active versus inactive cdu2

  • Analyze the temporal relationship between cdu2 expression and cytokine production

Such experiments would help establish whether cdu2 plays a direct role in modulating the host cytokine response to C. trachomatis serovar A infection.

What are the technical challenges in purifying enzymatically active recombinant cdu2?

Purifying enzymatically active recombinant deubiquitinases and deneddylases presents several technical challenges:

  • Maintaining structural integrity: Deubiquitinases often contain catalytic domains with specific structural requirements for activity. Expression conditions must be optimized to ensure proper folding and disulfide bond formation.

  • Avoiding autocleavage: Many deubiquitinases can self-process, potentially leading to heterogeneous preparations. Controlled expression conditions and rapid purification are essential.

  • Preventing co-purification of bacterial deubiquitinases: When expressed in E. coli, bacterial DUBs may contaminate the preparation. Multiple purification steps and appropriate controls are necessary.

  • Stability during purification: Enzymatic activity may be lost during purification steps. Stabilizing agents and activity assays at each purification stage help monitor activity retention.

  • Expression system selection: While E. coli is commonly used , eukaryotic expression systems might better preserve post-translational modifications that affect activity.

A recommended purification workflow would include:

  • IMAC (immobilized metal affinity chromatography) using His-tag

  • Size exclusion chromatography to remove aggregates

  • Ion-exchange chromatography for final purification

  • Activity testing after each step

  • Storage with stabilizing agents (e.g., glycerol, reducing agents)

Each batch of purified recombinant cdu2 should be validated with enzymatic assays before use in functional studies to ensure consistency in experimental results.

How might cdu2 be utilized in developing diagnostic tools for C. trachomatis infections?

Serological testing has potential for diagnosing invasive C. trachomatis infections, particularly when sample collection from infection sites is challenging . Cdu2 could be incorporated into diagnostic platforms in several ways:

  • Recombinant antigen-based serology: Similar to the line immunoassay approach described in the research, where defined recombinant antigens were used for serodiagnosis of severe and invasive C. trachomatis infections. This approach demonstrated high sensitivity (between 71% and 94%) and specificity (between 82% and 100%) for proteins like MOMP, CPAF, OMP2, and PmpD .

  • Multiplex antigen panels: Combining cdu2 with other identified immunogenic proteins could enhance diagnostic sensitivity and specificity. Research indicates that using multiple antigens improves diagnostic performance compared to single-antigen tests .

  • Serovar-specific diagnostics: If cdu2 contains serovar-specific epitopes, it could potentially help distinguish between ocular (serovar A-C), genital (serovar D-K), and LGV (serovar L1-L3) infections.

To evaluate cdu2's diagnostic potential, researchers should:

  • Assess antibody responses to cdu2 in patients with confirmed C. trachomatis infections

  • Compare responses between different clinical presentations (ocular, genital, LGV)

  • Determine sensitivity, specificity, positive and negative predictive values

  • Evaluate cross-reactivity with other bacterial species

The novel line immunoassay approach described in the research demonstrates promise for improved serodiagnosis in severe and invasive C. trachomatis infections and could serve as a model for cdu2-based diagnostic development .

What approaches can be used to study the role of cdu2 in bacterial-host interactions during infection?

Studying cdu2's role in bacterial-host interactions requires multiple complementary approaches:

  • Bacterial genetics:

    • Generate cdu2 knockout strains using targeted mutagenesis

    • Create point mutants with altered enzymatic activity

    • Develop fluorescently tagged cdu2 variants for localization studies

  • Cell infection models:

    • Compare different cell types that demonstrate serovar-specific restrictions

    • Utilize the cell lines described in the research: HVEC, HCK, HFK-2, HCjE, PMA-stimulated THP-1 cells

    • Monitor inclusion development, bacterial replication, and host response

  • Identification of host targets:

    • Immunoprecipitation coupled with mass spectrometry

    • Ubiquitome analysis comparing wild-type and cdu2-deficient infections

    • Yeast two-hybrid or proximity labeling approaches

  • Localization studies:

    • Similar to the approach used for CteG, create strains expressing epitope-tagged cdu2 (e.g., cdu2-2HA)

    • Perform time-course immunofluorescence to track cdu2 localization during infection

    • Co-localize with host cellular compartments and ubiquitinated substrates

  • Functional readouts:

    • Monitor global ubiquitination patterns during infection

    • Assess cytokine production profiles (particularly those showing serovar-specific patterns)

    • Evaluate immune pathway activation through reporter systems

The research approach used for CteG provides a valuable template: creating tagged versions of the protein, establishing its delivery into host cells, and tracking its localization throughout infection .

How can researchers address the technical challenges in comparing cdu2 activity across different C. trachomatis serovars?

Comparing cdu2 activity across different C. trachomatis serovars presents several technical challenges that researchers can address through careful experimental design:

  • Standardizing infection models:

    • Normalize bacterial loads for initial infection (MOI)

    • Account for differential growth rates between serovars in various cell types

    • Consider using cell types where all serovars of interest can establish infection

  • Genetic manipulation strategies:

    • Create chimeric strains where cdu2 from one serovar replaces the native gene in another

    • Develop inducible expression systems to control cdu2 levels

    • Employ CRISPR interference for partial knockdown when complete knockout is not viable

  • Activity measurement approaches:

    • Develop in situ enzyme activity assays using fluorescent substrates

    • Create reporter systems that respond to deubiquitination of specific targets

    • Employ quantitative proteomics to measure changes in the ubiquitome

  • Controlling for serovar-specific factors:

    • Account for differences in uptake and inclusion formation

    • Consider the influence of other effector proteins that may work synergistically with cdu2

    • Evaluate expression timing in relation to the developmental cycle

  • Data analysis considerations:

    • Normalize enzyme activity measurements to bacterial load

    • Account for host cell type-specific effects on substrate availability

    • Perform multivariate analysis to identify patterns across serovars and cell types

The research methodology described for comparing serovar replication in different cell types provides a useful framework, particularly the approaches for measuring inclusion development and controlling for differences in bacterial uptake .

What are the most promising research directions for understanding cdu2's role in C. trachomatis pathogenesis?

Based on current research, several promising directions emerge for further investigating cdu2's role in C. trachomatis pathogenesis:

  • Serovar-specific functions: Investigating whether differences in cdu2 sequence, expression, or activity contribute to the distinct tissue tropism and host interactions observed between serovars A, D, and L2 .

  • Host immune modulation: Exploring how cdu2's deubiquitinase activity might regulate key immune signaling pathways, potentially explaining the differential cytokine production observed between serovars .

  • Cell type-specific interactions: Determining whether cdu2 contributes to the ability of certain serovars to infect specific cell types, such as the restricted growth of serovar A in urogenital cells versus conjunctival cells .

  • Developmental regulation: Investigating whether cdu2 plays a role in transitions between elementary bodies and reticulate bodies during the chlamydial developmental cycle.

  • Host protein targeting: Identifying the specific host proteins targeted by cdu2's deubiquitinase and deneddylase activities, which could reveal key pathways manipulated during infection.

  • Therapeutic targeting: Exploring whether inhibition of cdu2 enzymatic activity could represent a novel therapeutic approach for treating C. trachomatis infections.

The most significant advances will likely come from combining multiple methodological approaches, including bacterial genetics, cell biology, biochemistry, and immunology, to build a comprehensive understanding of cdu2's role in the complex host-pathogen relationship.

What methodological innovations might advance our understanding of proteins like cdu2 in obligate intracellular pathogens?

Advancing research on proteins like cdu2 in obligate intracellular pathogens will require innovative methodological approaches:

  • Improved genetic manipulation tools: Developing more efficient transformation protocols and genetic tools for Chlamydia, including inducible gene expression systems and targeted mutagenesis approaches.

  • Advanced imaging techniques: Implementing super-resolution microscopy and live-cell imaging to track effector proteins like cdu2 in real-time during infection, similar to the approach used for tracking CteG localization .

  • Single-cell analysis platforms: Applying single-cell transcriptomics and proteomics to capture heterogeneity in host-pathogen interactions that may be missed in bulk analyses.

  • Organoid infection models: Utilizing three-dimensional tissue models that better recapitulate the complexity of native tissues, particularly for comparing ocular versus urogenital infections.

  • CRISPR screens in host cells: Identifying host factors required for cdu2 function through genome-wide CRISPR screens in susceptible cell lines.

  • Protein engineering approaches: Developing activity-based probes and biosensors to monitor deubiquitinase activity within living cells during infection.

  • Comparative systems biology: Integrating multi-omics data across different serovars, cell types, and time points to build predictive models of cdu2 function within the broader context of host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.