Recombinant Chlamydia trachomatis serovar A Na (+)-translocating NADH-quinone reductase subunit F (nqrF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chlamydia trachomatis serovar A Na(+)-translocating NADH-quinone Reductase Subunit F (NqrF)

Recombinant Chlamydia trachomatis serovar A Na(+)-translocating NADH-quinone reductase subunit F (NqrF) is a protein component of the NADH-quinone reductase (NQR) complex found in Chlamydia trachomatis serovar A . The NQR complex is an enzyme that catalyzes the transfer of electrons from NADH to quinone, coupled with the translocation of sodium ions across the membrane . NqrF is a subunit of this complex and is essential for its function .

Characteristics

CharacteristicDescription
Product TypeRecombinant Protein
SpeciesChlamydia trachomatis serovar A (strain HAR-13 / ATCC VR-571B)
Uniprot No.Q3KKV3
Tag InfoDetermined during production
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
StorageStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week .
Protein NamesRecommended name: Na(+)-translocating NADH-quinone reductase subunit F. Short name= Na(+)-NQR subunit F. Short name= Na(+)-translocating NQR subunit F. EC= 1.6.5.--. Alternative name(s): NQR complex subunit F, NQR-1 subunit F .
Gene NamesName: nqrF. Ordered Locus Names: CTA_0806
Expression Region1-431
Sourcein vitro E. coli expression system
AA SequenceMTWLSGLYSIFVASAAFCSLGLILVAVILLSRKFLIKVHPCKLKINNDDSLTKTVDSGKTLLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSKQQLEQGWRLSCQTKVQHDLCLEVEERYFNASSWEGTVVSNENVATFIKELVLSVDPSRPIPFKPGGYLQITVPP...YKTNTSDWKQTMDPQYYSDWETFHLFDQVIDNLSLDTDSANKAYSLASYPAELPLIKFNVRIATPPFVDQAPDPTIPWGVCSSYIFSLKPGDKVMISGPYGESFMKEDNRPVIFLIGGAGSSFGRSHILDLLLNKHSDRELTLWYGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQEDLDQGWDKNDPIKTNFLFKAFELRQLSHLPNPEDYLYYVCGPALHNSSILTLLDNYGIE RSSIVLDDFGS

Function

The NqrF subunit is part of the larger NQR complex, which is crucial for energy generation in Chlamydia trachomatis . This complex couples the oxidation of NADH to the reduction of quinone with the translocation of Na+ ions across the cytoplasmic membrane. The electrochemical gradient of Na+ ions that is generated is then used to drive other cellular processes, such as ATP synthesis andFlagellar motion.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nqrF; CTA_0806; Na(+-translocating NADH-quinone reductase subunit F; Na(+-NQR subunit F; Na(+-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Target Names
nqrF
Target Protein Sequence
MTWLSGLYSIFVASAAFCSLGLILVAVILLSRKFLIKVHPCKLKINNDDSLTKTVDSGKT LLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSKQQLEQGWRLSCQTK VQHDLCLEVEERYFNASSWEGTVVSNENVATFIKELVLSVDPSRPIPFKPGGYLQITVPP YKTNTSDWKQTMDPQYYSDWETFHLFDQVIDNLSLDTDSANKAYSLASYPAELPLIKFNV RIATPPFVDQAPDPTIPWGVCSSYIFSLKPGDKVMISGPYGESFMKEDNRPVIFLIGGAG SSFGRSHILDLLLNKHSDRELTLWYGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQ EDLDQGWDKNDPIKTNFLFKAFELRQLSHLPNPEDYLYYVCGPALHNSSILTLLDNYGIE RSSIVLDDFGS
Uniprot No.

Target Background

Function

The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions coupled with Na+ ion transport from the cytoplasm to the periplasm. The initial step is catalyzed by NqrF, which accepts electrons from NADH and reduces ubiquinone-1 to ubisemiquinone via a one-electron transfer mechanism.

Database Links

KEGG: cta:CTA_0806

Protein Families
NqrF family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is nqrF and what is its function in C. trachomatis?

nqrF is the gene encoding the F subunit of the Na(+)-translocating NADH-quinone reductase complex (Na+-NQR) in Chlamydia trachomatis. This complex serves as a crucial component of the chlamydial respiratory chain and energy metabolism system. Unlike more complex organisms with mitochondrial respiratory chains, C. trachomatis possesses a simplified respiratory chain that includes the Na+-NQR complex, succinate dehydrogenase, cytochrome bd oxidase, and an A1-A0-ATPase .

The nqrF subunit specifically functions as part of the Na+-NQR complex, which couples the oxidation of NADH to the translocation of sodium ions across the bacterial membrane. This process generates a sodium gradient that energizes the membrane and supports various physiological processes essential for chlamydial infection and growth . The enzyme essentially serves as an electron transport component that contributes to ATP synthesis through a sodium-dependent mechanism rather than the more common proton-dependent mechanism found in mitochondria.

Methodologically, researchers can identify the function of nqrF through comparative genomic analysis, biochemical assays measuring NADH oxidation coupled to sodium translocation, and by studying the effects of specific inhibitors like HQNO (2-heptyl-4-hydroxyquinoline-N-oxide) on chlamydial metabolism and growth . These approaches have demonstrated that C. trachomatis generates a Na+ gradient to energize its membrane, which is essential for its infection and growth, and that its energy dependence on the host cell is only partial.

How is recombinant nqrF typically produced for research purposes?

Recombinant nqrF from Chlamydia trachomatis serovar A is typically produced using heterologous expression systems, with E. coli being the most common host. The methodological approach involves several key steps for successful production and purification:

  • Gene cloning: The full-length nqrF gene (encoding amino acids 1-431) is amplified from C. trachomatis serovar A genomic DNA using PCR with specific primers designed to incorporate appropriate restriction sites .

  • Vector construction: The amplified gene is inserted into an expression vector that includes:

    • An N-terminal His-tag for purification purposes

    • A strong promoter (often T7) for high-level expression

    • Antibiotic resistance markers for selection

  • Transformation: The recombinant vector is transformed into an E. coli expression strain optimized for protein production, typically BL21(DE3) or similar strains with reduced protease activity.

  • Expression induction: Bacterial cultures are grown to appropriate density (usually mid-log phase) before inducing protein expression, typically using IPTG for T7-based systems.

  • Purification: The expressed protein is purified using affinity chromatography with Ni-NTA or similar matrices that bind the His-tag, followed by additional purification steps if needed.

  • Quality control: The purity is assessed using SDS-PAGE, with typical preparations achieving >90% purity .

  • Storage preparation: The purified protein is typically lyophilized or stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to enhance stability .

The specific storage and handling recommendations for recombinant nqrF include reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL and addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . Aliquoting is necessary to avoid repeated freeze-thaw cycles, which can compromise protein stability and activity.

How does nqrF contribute to C. trachomatis energy metabolism?

The nqrF subunit plays a critical role in Chlamydia trachomatis energy metabolism as part of the Na+-translocating NADH-quinone reductase (Na+-NQR) complex. Understanding this contribution requires examining the unique energetic requirements of this obligate intracellular pathogen:

  • Respiratory chain component: C. trachomatis possesses a simplified respiratory chain compared to mitochondria, consisting of Na+-NQR, succinate dehydrogenase, cytochrome bd oxidase, and an A1-A0-ATPase . The nqrF subunit functions within this system to couple NADH oxidation to sodium ion translocation.

  • Sodium gradient generation: The Na+-NQR complex, including nqrF, generates a sodium gradient across the bacterial membrane instead of the proton gradient typically found in mitochondria and many bacteria . This sodium motive force energizes the membrane and drives various cellular processes.

  • ATP synthesis: The sodium gradient established by Na+-NQR activity is utilized by the A1-A0-ATPase to synthesize ATP, providing the bacterium with energy for growth and replication .

  • Metabolic independence: Research has shown that C. trachomatis has an active oxidative metabolism that is resistant to inhibitors of the mitochondrial respiratory chain but sensitive to inhibitors of Na+-NQR like HQNO . This suggests that while C. trachomatis remains dependent on the host cell for certain nutrients, it maintains some energetic autonomy through its unique respiratory chain.

  • Growth support: Experimental evidence indicates that Na+-NQR activity is particularly important for sustaining the aerobic metabolism required for reticulate body (RB) growth during the chlamydial developmental cycle .

Methodologically, research on nqrF's contribution to energy metabolism has been conducted by studying C. trachomatis in situ within intact infected cells and in permeabilized infected cells. The data demonstrate that the bacterium sustains an active oxidative metabolism that is resistant to the inhibitors of the mitochondrial respiratory chain but sensitive to HQNO, supporting the operation of an active oxidative phosphorylation system powered by a sodium gradient rather than a proton gradient .

What experimental methods are used to study nqrF activity?

Several sophisticated experimental methods are employed to study the activity of recombinant nqrF and the Na+-NQR complex in Chlamydia trachomatis:

  • Enzyme activity assays:

    • NADH oxidation measurement: Spectrophotometric monitoring of NADH consumption (decrease in absorbance at 340 nm) in the presence of purified recombinant nqrF or membrane preparations.

    • Quinone reduction assays: Tracking the reduction of quinone analogs (such as ubiquinone-1 or menadione) coupled to NADH oxidation.

    • Sodium ion translocation: Using sodium-sensitive fluorescent dyes or radioactive sodium tracers to measure sodium movement across membranes or proteoliposomes containing reconstituted Na+-NQR.

  • Inhibitor studies:

    • HQNO (2-heptyl-4-hydroxyquinoline-N-oxide): A specific inhibitor of Na+-NQR used to confirm activity and study functional impacts of enzyme inhibition .

    • Monensin experiments: Using this Na+/H+ exchanger to disrupt sodium gradients and assess the importance of sodium motive force in various chlamydial processes .

  • In situ respiratory measurements:

    • Oxygen consumption: Using oxygen electrodes to measure respiratory activity in intact infected cells or in permeabilized infected cells .

    • ADP-stimulated respiration: Evaluating the coupling between respiration and ATP synthesis by measuring the increase in oxygen consumption when ADP is added to permeabilized infected cells .

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interactions between nqrF and other subunits of the Na+-NQR complex.

    • Cross-linking experiments to capture transient interactions during electron transfer.

  • Expression and localization analysis:

    • Immunoblotting to detect nqrF expression during different stages of the chlamydial developmental cycle.

    • Immunofluorescence microscopy to localize the protein within bacterial cells.

The application of these methods has revealed that C. trachomatis maintains an active respiratory metabolism that is coupled to sodium-dependent synthesis of ATP. Researchers have shown that in digitonin-permeabilized infected HeLa cells, chlamydial respiratory activity is stimulated by ADP, supporting the operation of an active oxidative phosphorylation system . These findings highlight the importance of Na+-NQR activity for bacterial growth and development.

How does the Na+ gradient generated by the Na+-NQR complex affect C. trachomatis infection and growth?

The sodium gradient generated by the Na+-NQR complex, of which nqrF is a key component, plays a critical role in Chlamydia trachomatis infection and growth through several interconnected mechanisms:

  • Energetic support for developmental cycle: C. trachomatis has specific energy requirements during different stages of its unique biphasic developmental cycle (alternating between elementary bodies and reticulate bodies). The Na+ gradient provides essential energy for:

    • Differentiation from elementary bodies (EBs) to reticulate bodies (RBs)

    • Protein synthesis and metabolism during RB replication

    • Redifferentiation from RBs back to EBs

  • Experimental evidence from inhibitor studies: When researchers disrupt the Na+ gradient using specific inhibitors, significant impacts on chlamydial development are observed:

    • HQNO (Na+-NQR inhibitor) experiments show decreased chlamydial protein levels and reduced inclusion size at both early (1 hour post-infection) and late (12 hours post-infection) timepoints, while not affecting the initial infection rate . This indicates that Na+-NQR activity is particularly important for RB growth rather than initial EB attachment and entry.

    • Monensin (Na+/H+ exchanger) treatment causes dramatic inhibition of infection, inclusion size, and chlamydial protein content, providing strong evidence that the Na+ gradient is essential for multiple aspects of the chlamydial life cycle .

  • Metabolic independence from host: The Na+-driven energy production system allows C. trachomatis to maintain partial energetic independence from the host cell, which may be a crucial adaptation for its intracellular lifestyle. Experimental data shows that chlamydial respiratory activity is resistant to inhibitors of the mitochondrial respiratory chain but sensitive to Na+-NQR inhibitors .

  • ATP synthesis coupling: In digitonin-permeabilized infected cells, chlamydial respiratory activity increases in response to ADP addition, indicating that the Na+ gradient drives oxidative phosphorylation for ATP production . This coupling is essential for energy-dependent processes throughout infection.

The methodological approach to studying these effects typically involves selective permeabilization of host cell membranes while maintaining bacterial membrane integrity, allowing researchers to directly measure chlamydial respiratory activity and its response to various substrates and inhibitors. This experimental evidence collectively demonstrates that the Na+ gradient generated by Na+-NQR is fundamental to C. trachomatis bioenergetics and represents a potential target for therapeutic intervention.

What are the implications of the rrn-nqrF plasticity zone for genetic manipulation in Chlamydia?

The region between the rRNA operon (rrn) and the nqrF gene represents a significant "plasticity zone" in Chlamydia, with important implications for genetic manipulation and understanding chlamydial evolution:

  • Natural recombination hotspot: Research on Chlamydia suis (a close relative of C. trachomatis) has revealed that the rrn-nqrF intergenic region is highly susceptible to transformation and genetic exchange . This makes it particularly valuable for genetic engineering approaches in these historically difficult-to-manipulate organisms.

  • Experimental evidence for genetic tractability: Studies have demonstrated that the rrn-nqrF region of C. suis is highly susceptible to transformation, resulting in complete vector integration upstream of nqrF without interrupting adjacent genes . This characteristic makes it an ideal target for genetic manipulation strategies.

  • Methodological approaches for genetic manipulation:

    • Integration vectors targeting the rrn-nqrF region can be designed with homologous flanking sequences

    • Transformation can be achieved using established protocols for chlamydial transformation

    • Selection markers and reporter genes can be integrated for tracking and experimental purposes

    • The natural plasticity of this region may enhance integration efficiency compared to other genomic locations

  • Evolutionary significance: The rrn-nqrF region has been implicated in horizontal gene transfer events, including the acquisition of tetracycline resistance in C. suis . This represents one of the few documented cases of recent inter-phylum horizontal gene transfer among Chlamydiota, highlighting the region's natural propensity for genetic exchange.

  • Experimental design considerations:

    • Vector design should include sufficient homologous sequence for recombination

    • Care must be taken to avoid disrupting essential genes or regulatory elements

    • Selection strategies must account for the obligate intracellular lifestyle of Chlamydia

    • Verification of integration should include both phenotypic and genotypic confirmation

This genomic plasticity zone provides several advantages for researchers:

  • It offers a relatively safe harbor for introducing foreign DNA without disrupting essential functions

  • The natural recombination tendency increases transformation efficiency

  • Its conservation across Chlamydia species allows similar approaches to be applied to different chlamydial pathogens

  • The proximity to nqrF provides opportunities for studying this gene's function through complementation or reporter fusion approaches

For researchers seeking to genetically manipulate C. trachomatis, the rrn-nqrF plasticity zone represents a valuable target that may significantly enhance the still relatively limited genetic toolkit available for chlamydial research .

How can inhibitors of Na+-NQR be used to study C. trachomatis metabolism?

Inhibitors of Na+-NQR, particularly HQNO (2-heptyl-4-hydroxyquinoline-N-oxide), provide powerful tools for investigating C. trachomatis metabolism through selective disruption of the sodium-dependent respiratory chain. Their application involves several sophisticated methodological approaches:

The methodological approach typically involves carefully designed experiments where:

  • Host cells are infected with C. trachomatis under controlled conditions

  • HQNO is applied at specific concentrations and timepoints

  • Multiple readouts are measured, including respiratory activity, inclusion size, bacterial numbers, and protein synthesis

  • Controls include both untreated infected cells and cells treated with inhibitors of host metabolism

These approaches have revealed that Na+-NQR inhibition decreases chlamydial protein levels and inclusion size, supporting the critical role of this complex in sustaining the aerobic metabolism required for bacterial growth .

What are the methodological challenges in studying nqrF function in situ?

Investigating nqrF function within intact Chlamydia trachomatis during infection presents several significant methodological challenges that researchers must address:

  • Discriminating bacterial and host cell metabolism:

    • C. trachomatis is an obligate intracellular pathogen, making it difficult to distinguish its metabolic activities from those of the host cell.

    • Methodological solution: Use of selective permeabilization with agents like digitonin that preferentially permeabilize the host cell plasma membrane while leaving bacterial membranes intact. This allows researchers to introduce specific substrates and inhibitors to bacterial components while monitoring responses .

  • Maintaining physiological relevance:

    • Purified recombinant nqrF may not fully recapitulate the function of the protein within the intact Na+-NQR complex and cellular environment.

    • Methodological solution: Development of cell-based assays that maintain the bacterial structural integrity while allowing manipulation and measurement of specific activities.

  • Temporal dynamics of expression and activity:

    • nqrF expression and activity may vary throughout the chlamydial developmental cycle.

    • Methodological solution: Synchronized infection protocols followed by time-course sampling to capture stage-specific differences in activity.

  • Limited genetic manipulation options:

    • Despite recent advances, genetic manipulation of C. trachomatis remains challenging.

    • Methodological solution: Use of chemical genetics approaches with specific inhibitors like HQNO and comparative studies with related bacteria where genetic systems are more established.

  • Measurement of sodium gradients:

    • Detecting and quantifying sodium gradients across bacterial membranes within host cells is technically difficult.

    • Methodological solution: Sodium-sensitive fluorescent probes with appropriate subcellular targeting, or use of radioisotope-based flux measurements in carefully controlled systems.

  • Respiratory activity quantification:

    • Measuring the specific contribution of nqrF to respiratory activity within infected cells.

    • Methodological solution: Oxygen consumption measurements in permeabilized infected cells with defined substrate and inhibitor combinations to isolate the contribution of Na+-NQR .

  • Distinguishing direct and indirect effects:

    • Determining whether observed phenotypes are directly due to nqrF inhibition or secondary effects.

    • Methodological solution: Careful experimental design with appropriate controls, including the use of structurally distinct inhibitors with the same target, and rescue experiments where possible.

These challenges have been addressed through innovative experimental approaches such as studying C. trachomatis in situ within intact infected cells and in permeabilized infected cells, allowing researchers to demonstrate that the bacterium sustains an active oxidative metabolism that is coupled to sodium-dependent synthesis of ATP . The continued development of methodologies to overcome these challenges will be crucial for advancing our understanding of nqrF function and chlamydial bioenergetics.

How do mutations in nqrF affect C. trachomatis virulence and survival?

Understanding the impact of nqrF mutations on Chlamydia trachomatis virulence and survival requires sophisticated experimental approaches due to the obligate intracellular nature of this pathogen. While direct experimental data on nqrF mutations in C. trachomatis is limited, several methodological approaches can be employed to investigate this question:

  • Site-directed mutagenesis strategies:

    • Target conserved functional domains in recombinant nqrF to create specific mutations

    • Develop transformation vectors targeting the chromosomal nqrF gene using the natural recombination potential of the rrn-nqrF region

    • Assess the impact of these mutations on protein function in both recombinant systems and, where possible, in the native organism

  • Functional assessment methods:

    • Measure NADH oxidation activity with wild-type versus mutant nqrF

    • Quantify sodium translocation efficiency using sodium-sensitive fluorescent probes

    • Evaluate respiratory chain function through oxygen consumption measurements

    • Assess membrane potential generation using potential-sensitive dyes

  • Virulence and survival readouts:

    • Developmental cycle progression: Monitor the transition between elementary bodies (EBs) and reticulate bodies (RBs) using microscopy and stage-specific markers

    • Inclusion formation and growth: Quantify inclusion size and morphology in cells infected with wild-type versus mutant strains

    • Bacterial replication: Measure genome copy number and infectious progeny production

    • Host response: Evaluate differences in inflammatory response or cell death pathways

  • Predictive approaches:

    • Comparative analysis with Na+-NQR inhibition studies, which have shown that HQNO treatment decreases chlamydial protein levels and inclusion size

    • Extrapolation from sodium gradient disruption experiments with monensin, which causes drastic inhibition of infection, inclusion size, and chlamydial protein content

Based on current understanding of Na+-NQR function in C. trachomatis, mutations affecting nqrF would be expected to:

The methodological approaches described provide a framework for investigating the relationship between nqrF function and C. trachomatis virulence and survival, contributing to our understanding of the bacterium's unique energy metabolism and its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.