Recombinant Chlamydia trachomatis serovar B Deubiquitinase and deneddylase Dub2 (cdu2)

Shipped with Ice Packs
In Stock

Description

Chlamydia trachomatis as a Pathogen

Chlamydia trachomatis is a Gram-negative bacterium that functions as an obligate intracellular parasite, causing various diseases in humans including sexually transmitted urogenital infections and ocular trachoma. This pathogen has evolved sophisticated mechanisms to manipulate host cellular processes to establish its replicative niche within host cells. C. trachomatis bacteria are ovoid in shape, nonmotile, and although they do not form spores, their elementary bodies function similarly to spores when released into the host environment . Different serovars of C. trachomatis are associated with distinct clinical manifestations, with serovars A-C primarily causing trachoma, serovars D-K causing urogenital infections, and serovars L1-L3 causing lymphogranuloma venereum .

Ubiquitination and Deubiquitinases

Ubiquitination represents a critical post-translational modification process in eukaryotic cells where ubiquitin, a small protein, is attached to substrate proteins. This process regulates numerous cellular functions including protein degradation, trafficking, and signaling pathways. Deubiquitinases (DUBs) counteract this process by removing ubiquitin from modified proteins, thereby providing precise regulation of ubiquitin-dependent processes. Many pathogens, including C. trachomatis, have evolved mechanisms to interfere with host ubiquitination systems to promote their survival and replication within the host environment.

Enzymatic Properties

ChlaDUB2 functions as both a deubiquitinase and a deneddylase, capable of cleaving ubiquitin and the related modifier NEDD8 from modified substrates. Comparative studies of ChlaDUB2 and ChlaDUB1 have revealed distinct differences in their hydrolytic activities, particularly regarding di- and polyubiquitin chains . Both enzymes demonstrate similar ability to cleave monoubiquitin-based substrates such as ubiquitin aminomethylcoumarin (Ub-AMC), indicating comparable activity toward single ubiquitin moieties .

Comparison of Enzymatic Activities

PropertyChlaDUB1ChlaDUB2
Cleavage of Ub-AMCEfficientEfficient
Cleavage of diubiquitinRapid hydrolysisInefficient
Processing of polyubiquitinated GFPEfficient disassembly to monoubiquitinDepletion of substrate without significant monoubiquitin production
Distal ubiquitin bindingPresentPresent
Additional ubiquitin binding sitesMay differ from ChlaDUB2May differ from ChlaDUB1

Functional Implications

The distinct enzymatic properties of ChlaDUB1 and ChlaDUB2 suggest specialized roles for these enzymes during C. trachomatis infection. The difference in activity with longer ubiquitinated substrates may reflect adaptation to different target proteins in the host cell . This functional specialization may allow the bacterium to modulate different aspects of host ubiquitin signaling simultaneously, potentially contributing to its ability to establish and maintain its intracellular niche.

Understanding these functional differences could provide insights into how C. trachomatis manipulates host cellular processes through deubiquitination and could potentially identify new targets for therapeutic intervention. Further research into the specific host substrates targeted by each enzyme would significantly advance our understanding of their roles in pathogenesis.

Overview of C. trachomatis Serovars

C. trachomatis is classified into different serovars based on antigenic differences in the major outer membrane protein. These serovars are associated with different disease manifestations: serovars A-C cause trachoma, serovars D-K cause urogenital infections, and serovars L1-L3 cause lymphogranuloma venereum . Genetic variations between serovars can result in differences in protein structure and function, potentially affecting virulence and host interactions.

Serovar-Specific Variations in ChlaDUB2

Different serovars of C. trachomatis express variants of ChlaDUB2, with potential differences in amino acid sequence and consequently in structure and function. The available data primarily describes recombinant forms from serovar L2, L2b, and D/UW-3/Cx, with respective gene designations CTL0246, CTLon_0242, and CT867 . These different gene designations reflect the genomic organization in different serovars, while potentially encoding proteins with slightly different properties.

Commercial sources offer recombinant ChlaDUB2 from various serovars, produced in expression systems such as E. coli, yeast, baculovirus, or mammalian cells . These products typically achieve greater than 85-90% purity as determined by SDS-PAGE and may include tags such as His-tags to facilitate purification and detection .

Serovar B ChlaDUB2: Current Knowledge and Gaps

The specific properties of ChlaDUB2 from C. trachomatis serovar B, including its complete amino acid sequence, structural features, and enzymatic properties, are not well-documented in the available research literature. Given that serovar B is associated with ocular trachoma, understanding the specific characteristics of its ChlaDUB2 variant could provide valuable insights into the role of this enzyme in trachoma pathogenesis.

Further research is needed to characterize serovar B ChlaDUB2 and to determine whether it possesses unique properties compared to ChlaDUB2 from other serovars. Such investigations could involve cloning and expression of the gene, determination of its amino acid sequence, structural characterization, and comparative enzymatic assays with ChlaDUB2 from other serovars.

Recombinant ChlaDUB2 Proteins

Recombinant forms of ChlaDUB2 from various C. trachomatis serovars serve as valuable research tools for studying the structure, function, and potential inhibitors of this enzyme. These recombinant proteins enable in vitro studies of ChlaDUB2 enzymatic activity, structural analyses, and investigations into host-pathogen interactions. The availability of purified recombinant proteins facilitates comparative studies between ChlaDUB2 variants from different serovars and with other deubiquitinases.

Modulation of Host Ubiquitin Signaling

As a deubiquitinase, ChlaDUB2 likely plays a significant role in modulating host ubiquitin signaling during C. trachomatis infection. By removing ubiquitin from host proteins, it may interfere with processes such as protein degradation, immune signaling, and vesicular trafficking. These modifications to normal cellular processes could contribute to creating an environment favorable for bacterial replication and survival within the host cell.

The distinct substrate specificity of ChlaDUB2 compared to ChlaDUB1, particularly regarding di- and polyubiquitin chains, suggests these enzymes may target different host substrates or different types of ubiquitin modifications . This specialization may allow C. trachomatis to precisely manipulate multiple aspects of host ubiquitin signaling simultaneously, enhancing its ability to establish and maintain its intracellular niche.

Potential Contributions to Immune Evasion

Ubiquitination plays crucial roles in immune responses, including pathogen recognition, inflammatory signaling, and antigen presentation. By interfering with ubiquitin-dependent immune processes, ChlaDUB2 might contribute to C. trachomatis' ability to evade host immune responses. The ability to modulate host ubiquitination could potentially affect multiple immune pathways, including NF-κB signaling, autophagy, and interferon responses.

Further research is needed to identify the specific host substrates of ChlaDUB2 and to determine how its activity affects immune responses during infection. Such investigations could provide valuable insights into the mechanisms of Chlamydia pathogenesis and potentially identify new targets for therapeutic intervention.

Implications for Treatment and Vaccine Development

Understanding the structure and function of ChlaDUB2, including serovar-specific variations, could have significant implications for the development of new therapeutic approaches. As an enzyme that likely contributes to bacterial virulence and survival, ChlaDUB2 represents a potential target for novel antibacterial agents. Inhibitors of ChlaDUB2 could potentially interfere with the bacterium's ability to modulate host processes, making it more susceptible to host immune responses or conventional antibiotics.

Additionally, recombinant ChlaDUB2 proteins could serve as components of vaccines or as tools for studying immune responses to C. trachomatis. The identification of immunogenic epitopes within ChlaDUB2 could contribute to the development of subunit vaccines against Chlamydia infections, potentially providing protection against multiple serovars.

Characterization of Serovar B ChlaDUB2

A significant gap in current knowledge is the specific characterization of ChlaDUB2 from C. trachomatis serovar B. Future research should focus on determining its amino acid sequence, structural features, and enzymatic properties. Comparative studies with ChlaDUB2 from other serovars could provide insights into whether serovar-specific variations in this enzyme contribute to differences in disease manifestations, particularly in the context of ocular trachoma.

Cloning, expression, and purification of recombinant serovar B ChlaDUB2 would enable detailed biochemical and structural analyses. Enzymatic assays comparing its activity with ChlaDUB2 from other serovars could identify any functional differences that might be relevant to pathogenesis.

Identification of Host Substrates

The specific host proteins targeted by ChlaDUB2 remain largely unknown. Identification of these substrates would provide valuable insights into how this enzyme contributes to C. trachomatis pathogenesis. Several approaches could be employed to identify these targets:

  • Proteomic analyses of infected cells, comparing wild-type infection with infection by ChlaDUB2 mutants

  • In vitro deubiquitination assays with candidate substrates

  • Affinity purification approaches to identify host proteins that interact with ChlaDUB2

  • CRISPR-based screening to identify host factors that affect sensitivity to ChlaDUB2 activity

Understanding the specific substrates and pathways affected by ChlaDUB2 could significantly advance our understanding of Chlamydia pathogenesis and potentially identify new therapeutic targets.

Development of Specific Inhibitors

Given its potential role in pathogenesis, ChlaDUB2 represents an attractive target for novel antibacterial agents. The development of specific inhibitors of ChlaDUB2 would not only provide tools for studying its function but could also lead to new therapeutic approaches for C. trachomatis infections. Several approaches could be employed for inhibitor development:

  • Structure-based drug design, utilizing the determined structures of ChlaDUB2

  • High-throughput screening of chemical libraries against recombinant ChlaDUB2

  • Rational design approaches based on understanding of the catalytic mechanism

  • Peptide-based inhibitors targeting the substrate binding sites

Testing candidate inhibitors in cellular infection models would be crucial to evaluate their potential therapeutic efficacy and to understand how inhibition of ChlaDUB2 affects the chlamydial infection cycle.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
cdu2; CTB_8781; Deubiquitinase and deneddylase Dub2; ChlaDub2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Chlamydia trachomatis serovar B (strain TZ1A828/OT)
Target Names
cdu2
Target Protein Sequence
MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLL DADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPL TKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYNYIASPQQMREQLEGLA ASLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Uniprot No.

Target Background

Function
Effector proteins play a crucial role in modifying host cell physiology and promoting bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities.
Database Links

KEGG: ctz:CTB_8781

Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Q&A

What is ChlaDUB2 (cdu2) and what is its role in Chlamydia trachomatis infection?

ChlaDUB2 (cdu2), also designated as CT867, is a bacterial effector protein with deubiquitinase activity that is secreted by Chlamydia trachomatis during infection. Unlike its counterpart ChlaDUB1 (CT868), ChlaDUB2 functions as a dedicated deubiquitinase without acetyltransferase activity. It localizes to both the inclusion membrane and host cytosol after being delivered into the host cell environment .

The protein plays a significant role in modifying host cell processes during infection. Particularly, ChlaDUB2 contributes to Golgi apparatus fragmentation in infected cells, a key process in Chlamydia pathogenesis that facilitates nutrient acquisition and inclusion expansion . While inactivation studies have shown that ChlaDUB2 is not essential for establishing infection (unlike ChlaDUB1), its preserved function across Chlamydia species suggests evolutionary importance in the bacterial life cycle .

How does ChlaDUB2 differ structurally and functionally from ChlaDUB1?

While both ChlaDUB1 and ChlaDUB2 belong to the CE clan of cysteine proteases and share sequence similarities, they differ significantly in their functional capabilities:

FeatureChlaDUB1 (CT868)ChlaDUB2 (CT867)
ActivitiesDual: Lys63-deubiquitinase (DUB) and Lys-acetyltransferase (AcT)Single: Dedicated deubiquitinase (DUB)
LocalizationInclusion membrane onlyInclusion membrane and host cytosol
VR-3 helix residuesContains both Ub- and CoA-coordinating residuesContains only Ub-coordinating residues
Effect of inactivationEnhances sensitivity to IFN-γ, reduces infectivityDoes not impair infection
Role in host processesPrevents MCL-1 depletion and apoptosis, prevents GLUT-1 degradationPrimarily involved in Golgi fragmentation

The structural basis for these functional differences lies primarily in the VR-3 helix region, which contains catalytic residues that determine substrate specificity. In ChlaDUB1, this region facilitates interaction with both ubiquitin and acetyl-CoA, enabling its dual activities, while in ChlaDUB2, the residues are specialized for ubiquitin binding only .

What experimental systems are suitable for studying recombinant ChlaDUB2?

For studying recombinant ChlaDUB2, researchers should consider multiple experimental approaches:

  • Prokaryotic expression systems: E. coli expression systems (particularly BL21 derivatives) can be used for high-yield production of recombinant ChlaDUB2, typically with affinity tags (His, GST) for purification.

  • Eukaryotic expression systems: For functional studies where post-translational modifications might be important, mammalian cell-based expression (HEK293T, HeLa) or insect cell (Sf9, High Five) systems provide more physiologically relevant environments.

  • In vitro enzymatic assays: Purified recombinant ChlaDUB2 can be tested for deubiquitinating activity using:

    • Fluorogenic ubiquitin substrates (Ub-AMC)

    • Di-ubiquitin cleavage assays (particularly K63-linked di-Ub)

    • Polyubiquitin chain disassembly assays followed by Western blotting

  • Cellular models: Transfection of epithelial cell lines (HeLa, HEp-2) with recombinant ChlaDUB2 constructs can help examine localization patterns and effects on cellular processes like Golgi fragmentation .

The choice between these systems depends on research objectives - biochemical characterization requires purified protein from prokaryotic systems, while functional studies benefit from eukaryotic expression or targeted Chlamydia mutant strains.

How can I design experiments to specifically assess the deubiquitinase activity of recombinant ChlaDUB2?

To specifically assess the deubiquitinase activity of recombinant ChlaDUB2, implement a multi-tiered experimental approach:

  • In vitro enzymatic characterization:

    • Substrate specificity testing using different polyubiquitin chain types (K48, K63, K11, etc.)

    • Kinetic analysis using Ub-AMC as substrate to determine Km and Vmax values

    • DUB activity assays in the presence of different divalent cations to determine cofactor requirements

  • Targeted mutagenesis:

    • Generate catalytic cysteine mutants (typically C→S mutations) as negative controls

    • Create targeted mutations in the VR-3 helix region to examine residues critical for substrate binding

    • Compare wild-type and mutant activities quantitatively using fluorescence-based assays

  • Substrate identification:

    • Perform pull-down experiments using catalytically inactive ChlaDUB2 mutants to trap substrates

    • Employ ubiquitin remnant profiling in cells expressing ChlaDUB2 versus control cells

    • Validate identified substrates through targeted deubiquitination assays with purified components

  • Inhibitor profiling:

    • Test sensitivity to pan-DUB inhibitors (PR-619, NSC632839)

    • Assess sensitivity to cysteine protease inhibitors (NEM, iodoacetamide)

    • Develop activity-based probes specific for ChlaDUB2 catalytic site

These methodologies should be accompanied by appropriate controls, including comparison to the dual-activity enzyme ChlaDUB1 and other known bacterial DUBs .

What are the key considerations for expressing and purifying functional recombinant ChlaDUB2?

Expressing and purifying functional recombinant ChlaDUB2 presents several technical challenges that must be addressed:

  • Expression system selection:

    • Bacterial systems: BL21(DE3) strains with pET-based vectors enable high yield but may require optimization for solubility

    • Consider specialized strains like Rosetta (for rare codons) or SHuffle (for disulfide bond formation)

    • For structural studies, minimal media with isotope labeling (15N, 13C) may be required

  • Construct design optimization:

    • Include appropriate affinity tags (His6, GST, MBP) preferably with TEV/PreScission protease cleavage sites

    • Test multiple constructs with different N- and C-terminal boundaries to identify stable domains

    • Consider fusion partners (MBP, SUMO) that enhance solubility but can be removed during purification

  • Expression conditions:

    • Optimize induction parameters (temperature: typically 16-18°C for better folding; IPTG concentration: 0.1-0.5 mM)

    • Extended expression periods (16-24 hours) at lower temperatures often yield more active enzyme

    • Inclusion of specific additives (5-10% glycerol, low concentration of reducing agents) can improve stability

  • Purification strategy:

    • Multi-step approach: affinity chromatography → tag cleavage → ion exchange → size exclusion

    • Buffer optimization is critical: include reducing agents (DTT or TCEP, 1-5 mM) to maintain active-site cysteine

    • Maintain pH between 7.5-8.0 and include glycerol (10%) in storage buffers

    • Test enzyme activity at each purification step to ensure functionality is preserved

  • Quality control:

    • Assess purity by SDS-PAGE (>95% for enzymatic studies, >98% for structural studies)

    • Verify folding by circular dichroism or thermal shift assays

    • Confirm catalytic activity using simple DUB activity assays before proceeding to complex experiments

Storage considerations are also crucial - flash freezing in small aliquots with 10% glycerol and storage at -80°C will maintain activity for extended periods.

How can I establish a cellular model system to study ChlaDUB2 function during infection?

Establishing effective cellular models for studying ChlaDUB2 function during Chlamydia infection requires careful consideration of both host cell systems and bacterial manipulation approaches:

  • Cell line selection:

    • Epithelial cell lines (HeLa, HEp-2, A549) are standard models for Chlamydia infection

    • Consider polarized epithelial cells (Caco-2, MDCK) for more physiologically relevant models

    • For tissue-specific studies, primary cells from relevant tissues may be appropriate

  • Genetic manipulation approaches:

    • Bacterial perspective:

      • Generation of ChlaDUB2 knockout strains using newly available genetic tools for Chlamydia

      • Complementation studies with wild-type or mutant ChlaDUB2 to confirm phenotypes

      • Fluorescent protein tagging of ChlaDUB2 for live-cell visualization during infection cycle

    • Host cell perspective:

      • Overexpression of ChlaDUB2 in uninfected cells to identify effects independent of other bacterial factors

      • CRISPR/Cas9 modification of host targets to validate interaction pathways

      • Inducible expression systems to control timing of ChlaDUB2 activity

  • Experimental readouts:

    • Golgi fragmentation assessment using immunofluorescence microscopy of Golgi markers

    • Ubiquitination landscape analysis using ubiquitin-specific antibodies or mass spectrometry

    • Infectivity and inclusion development metrics (inclusion size, bacterial progeny production)

    • Host cell signaling pathway analysis using phospho-protein arrays or targeted Western blotting

  • Time-course considerations:

    • Synchronize infections using centrifugation-assisted inoculation

    • Analyze multiple timepoints (early: 2-8h; mid: 12-24h; late: 30-48h post-infection)

    • Use inducible expression systems to introduce ChlaDUB2 at different stages of the infection cycle

The ability to genetically manipulate Chlamydia, though still challenging, has significantly improved in recent years, enabling targeted study of effector proteins like ChlaDUB2 . When designing these experiments, researchers should include appropriate controls, such as ChlaDUB1 mutants for comparison and catalytically inactive ChlaDUB2 mutants.

What structural biology approaches are most suitable for studying ChlaDUB2 molecular mechanisms?

For elucidating the molecular mechanisms of ChlaDUB2 at atomic resolution, several complementary structural biology approaches should be considered:

  • X-ray crystallography:

    • Most suitable for obtaining high-resolution structures (potentially <2.0 Å) of ChlaDUB2

    • Requires systematic screening of crystallization conditions with purified protein

    • Co-crystallization with substrates or substrate analogs (e.g., ubiquitin-vinylsulfone) can capture enzyme-substrate complexes

    • As demonstrated with ChlaDUB1, can reveal detailed catalytic mechanisms and reaction intermediates

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable for larger complexes of ChlaDUB2 with host targets

    • Sample preparation is less restrictive than crystallography

    • Recent advances enable near-atomic resolution for smaller proteins

    • Can visualize conformational heterogeneity relevant to the catalytic cycle

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Enables study of protein dynamics in solution

    • Particularly powerful for mapping protein-protein interaction interfaces

    • Requires isotopically labeled protein (15N, 13C, 2H)

    • Can identify flexible regions that may be disordered in crystal structures

  • Small-angle X-ray scattering (SAXS):

    • Provides low-resolution envelope of protein structure in solution

    • Useful for confirming quaternary structure and oligomeric states

    • Complements higher-resolution techniques

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and conformational dynamics

    • Particularly valuable for identifying regions that undergo conformational changes upon substrate binding

    • Can provide insights into the role of specific domains in ChlaDUB2 function

Based on existing structures of related proteins like ChlaDUB1 and C. abortus ChlaDUB (which was resolved at 1.5 Å), X-ray crystallography has proven highly effective for this protein family . Structural studies should focus on the catalytic core and the VR-3 helix region, which distinguishes ChlaDUB2 as a dedicated DUB from its dual-function homolog ChlaDUB1.

How can I investigate the specific host targets of ChlaDUB2 during Chlamydia infection?

Identifying specific host targets of ChlaDUB2 requires systematic approaches combining proteomics, biochemistry, and cell biology:

  • Proximity-based labeling approaches:

    • Express ChlaDUB2 fused to BioID or TurboID biotin ligase in host cells

    • After biotin labeling, isolate biotinylated proteins and identify by mass spectrometry

    • Compare results between wild-type and catalytically inactive ChlaDUB2 to distinguish enzyme-substrate interactions from non-catalytic binding partners

  • Ubiquitinome analysis:

    • Perform global ubiquitinome profiling using diGly remnant antibodies and mass spectrometry

    • Compare cells infected with wild-type Chlamydia versus ChlaDUB2-deficient strains

    • Look for proteins with increased ubiquitination in the absence of ChlaDUB2

    • Validate candidates using targeted biochemical approaches

  • Immunoprecipitation-based approaches:

    • Use epitope-tagged ChlaDUB2 to pull down interacting proteins

    • Apply crosslinking strategies to capture transient enzyme-substrate interactions

    • Perform reciprocal co-immunoprecipitation to confirm interactions

    • Use ubiquitin-TUBE technology to enrich for ubiquitinated proteins that interact with ChlaDUB2

  • Candidate-based validation:

    • Based on the known role of ChlaDUB2 in Golgi fragmentation, assess ubiquitination status of key Golgi structural proteins

    • Examine ubiquitination of GTPases involved in Golgi structure maintenance

    • Compare ubiquitination patterns before and after infection or ChlaDUB2 expression

  • Functional validation:

    • Silence expression of candidate targets using siRNA/shRNA

    • Assess the impact on Chlamydia infection efficiency and Golgi fragmentation

    • Generate non-ubiquitinatable mutants of key targets to determine functional significance

The combined results from these approaches should converge on a set of high-confidence ChlaDUB2 substrates, particularly those involved in Golgi structure regulation, as both ChlaDUB1 and ChlaDUB2 are implicated in Golgi fragmentation during infection .

What are the current challenges in studying the enzymatic mechanism of ChlaDUB2 and how can they be addressed?

Research into ChlaDUB2 enzymatic mechanisms faces several significant challenges that require innovative approaches:

  • Catalytic mechanism resolution:

    • Challenge: Unlike ChlaDUB1, which has been characterized by crystal structures of reaction intermediates, detailed mechanistic understanding of ChlaDUB2 is limited

    • Solution: Generate trapped intermediates using mechanism-based probes (e.g., ubiquitin-vinylsulfone, ubiquitin-aldehyde) for structural studies

    • Approach: Employ time-resolved crystallography or cryo-EM to capture different stages of the catalytic cycle

  • Substrate specificity determination:

    • Challenge: The preference of ChlaDUB2 for specific ubiquitin chain types or substrates remains poorly defined

    • Solution: Develop comprehensive in vitro assays using defined ubiquitin chain types (K48, K63, K11, linear, branched)

    • Approach: Combine with mass spectrometry-based techniques to precisely quantify reaction kinetics with different substrates

  • Function-structure relationship:

    • Challenge: Understanding how the VR-3 helix region specializes ChlaDUB2 as a dedicated DUB versus the dual-function ChlaDUB1

    • Solution: Create chimeric proteins and point mutants targeting residues within the VR-3 helix

    • Approach: Test gain-of-function mutations that might confer acetyltransferase activity to ChlaDUB2

  • Temporal regulation:

    • Challenge: Understanding when ChlaDUB2 is secreted and active during the infection cycle

    • Solution: Develop tools for temporal control of ChlaDUB2 activity during infection

    • Approach: Engineer strains with inducible expression or degradation of ChlaDUB2

  • Inhibitor development:

    • Challenge: Lack of specific inhibitors for mechanistic and functional studies

    • Solution: Structure-based design of selective inhibitors using available structural data

    • Approach: Fragment-based screening or in silico docking approaches followed by biochemical validation

  • Genetic manipulation limitations:

    • Challenge: Despite recent advances, genetic manipulation of Chlamydia remains challenging

    • Solution: Utilize newly developed transformation methods and CRISPR-based approaches

    • Approach: Collaborate with laboratories specializing in Chlamydia genetics to develop targeted mutant strains

Addressing these challenges requires interdisciplinary approaches combining structural biology, biochemistry, cell biology, and microbiology. The significant progress made in understanding ChlaDUB1 provides a valuable framework for comparable studies of ChlaDUB2, particularly by focusing on the differences in the VR-3 helix region that determine substrate specificity and catalytic activity.

How does ChlaDUB2 compare to other bacterial deubiquitinases and what evolutionary insights can be gained?

Comparative analysis of ChlaDUB2 with other bacterial deubiquitinases reveals important evolutionary patterns and functional specializations:

  • Structural comparisons:

    • ChlaDUB2 belongs to the CE clan of cysteine proteases, similar to other bacterial DUBs like SseL (Salmonella) and OspG (Shigella)

    • Unlike many bacterial DUBs that are structurally similar to eukaryotic counterparts, the Chlamydia DUBs have unique structural features, particularly the VR-3 helix region

    • The specialized DUB activity of ChlaDUB2 versus the dual DUB/AcT activity of ChlaDUB1 represents an interesting evolutionary divergence after gene duplication

  • Functional comparisons:

    Bacterial DUBOrganismStructural FamilyHost TargetsInfection Role
    ChlaDUB2 (CT867)C. trachomatisCE clanGolgi-associated proteinsGolgi fragmentation
    ChlaDUB1 (CT868)C. trachomatisCE clanMCL-1, GLUT-1Anti-apoptosis, metabolism
    SseLSalmonellaCE clanTNFR-associated proteinsAnti-inflammatory
    OspGShigellaKinase-likeIκBαNF-κB inhibition
    ElaDE. coliUSP-likeUnknownUnknown
  • Evolutionary insights:

    • The presence of ChlaDUB homologs across Chlamydia species (including C. abortus) suggests these are ancient virulence factors

    • The specialization of ChlaDUB2 as a dedicated DUB likely reflects adaptation to specific host processes

    • Conservation of catalytic residues across bacterial DUBs points to convergent evolution targeting similar host defense mechanisms

    • The VR-3 helix configuration differentiates ChlaDUB homologs, with residue variations determining their functional specialization

  • Host adaptation:

    • Species-specific variations in ChlaDUB2 sequence may correlate with host tropism

    • Analysis of selective pressure on ChlaDUB2 across Chlamydia species can identify host-adaptation signatures

    • Comparing ChlaDUB2 activity against host proteins from different species could reveal host-specificity determinants

This comparative analysis highlights how bacterial pathogens have evolved sophisticated mechanisms to manipulate the host ubiquitin system, with ChlaDUB2 representing a specialized enzyme dedicated to deubiquitination activities that support Chlamydia's intracellular lifestyle.

How do the functions of ChlaDUB2 integrate with other Chlamydia effectors in coordinating host-pathogen interactions?

The integration of ChlaDUB2 with other Chlamydia effectors creates a coordinated network for manipulating host cellular processes:

  • Temporal coordination:

    • Different effectors are deployed at distinct stages of the infection cycle

    • Early effectors facilitate invasion and initial inclusion establishment

    • Mid-cycle effectors like ChlaDUB2 participate in inclusion expansion and nutrient acquisition

    • Late effectors prepare the host cell for EB release

    • This temporal program ensures appropriate modification of host processes at each stage

  • Functional synergy with other effectors:

    • Golgi fragmentation network: While ChlaDUB2 contributes to Golgi fragmentation through deubiquitination activities, it likely works in concert with other effectors:

      • Inc proteins that tether the inclusion to Golgi mini-stacks

      • Effectors that modify host cytoskeleton

      • Lipid-modifying enzymes that alter membrane properties

    • Immune evasion coordination:

      • Multiple effectors target different aspects of host immune response

      • While some effectors directly inhibit NF-κB signaling, ChlaDUB2 may modulate ubiquitin-dependent immune signaling pathways

      • This creates redundancy in immune evasion strategies

  • Targeting of common host processes through different mechanisms:

    Host ProcessChlaDUB2 RoleComplementary EffectorsCombined Effect
    Golgi structureDeubiquitination of structural componentsCT813/InaC (actin remodeling)Enhanced nutrient acquisition
    Membrane traffickingModulation of ubiquitin-dependent sortingCPAF (cleaves SNAREs)Redirected vesicle traffic to inclusion
    Host cell survivalUnknown specific targetsChlaDUB1 (stabilizes MCL-1)Extended host cell viability
    Immune signalingPotential deubiquitination of signaling componentsCT441 (inhibits NF-κB)Comprehensive immune evasion
  • Evolutionary specialization:

    • The evolution of dedicated functions (ChlaDUB2 as DUB, ChlaDUB1 as dual DUB/AcT) allows fine-tuned control of distinct host processes

    • This specialization enables precise manipulation of host pathways with minimal cross-interference between effectors

    • The combined effect creates an optimized intracellular environment for bacterial replication

Understanding these functional interactions requires systems-level approaches combining genetics, proteomics, and cell biology to map the complex network of effector-host interactions throughout the Chlamydia infection cycle.

What insights can ChlaDUB2 research provide for development of anti-Chlamydia therapeutic strategies?

Research on ChlaDUB2 offers several promising avenues for development of novel therapeutic strategies against Chlamydia infections:

  • Targeted inhibitor development:

    • ChlaDUB2's enzymatic activity and specialized structure present opportunities for selective inhibition

    • Structure-based drug design targeting the unique catalytic site could yield specific inhibitors

    • High-throughput screening using in vitro deubiquitinase assays can identify lead compounds

    • Potential advantages include reduced risk of affecting human DUBs due to structural differences

  • Attenuated vaccine development:

    • ChlaDUB2-deficient Chlamydia strains could serve as attenuated vaccine candidates

    • If ChlaDUB2 contributes to immune evasion, its inactivation might enhance immune recognition while allowing limited replication

    • Combined inactivation of multiple effectors (e.g., ChlaDUB1 and ChlaDUB2) could generate optimally attenuated strains

    • This approach addresses the long-standing challenge of developing a Chlamydia vaccine

  • Host-directed therapeutic strategies:

    • Identification of ChlaDUB2 host targets enables alternative approaches that stabilize these targets

    • Compounds that protect key host proteins from deubiquitination without directly targeting bacterial factors

    • This approach may have a higher barrier to resistance development

    • Could potentially address multiple intracellular pathogens that manipulate similar host pathways

  • Potential therapeutic applications beyond Chlamydia:

    Therapeutic ApproachMechanismPotential AdvantagesResearch Requirements
    Small-molecule DUB inhibitorsDirect inhibition of ChlaDUB2Specific targeting of bacterial factorDetailed structural understanding of catalytic mechanism
    Peptide-based inhibitorsCompetitive binding to substrate sitesPotentially higher specificityIdentification of exact substrate binding motifs
    Host-factor stabilizationProtection of ChlaDUB2 targetsBroader activity against multiple pathogensPrecise identification of critical host targets
    Combination approachesSimultaneous targeting of multiple effectorsReduced resistance developmentComprehensive understanding of effector networks
  • Biomarker potential:

    • Antibodies against ChlaDUB2 might serve as diagnostic markers for Chlamydia infection

    • Differences in ChlaDUB2 across serovars could enable strain-specific diagnostics

    • Structural features unique to ChlaDUB2 could be exploited for selective detection systems

The path from basic research on ChlaDUB2 to therapeutic applications requires bridging several knowledge gaps, particularly regarding its precise host targets and their roles in pathogenesis. Nevertheless, the unique features of this bacterial effector make it a promising target for novel anti-Chlamydial strategies .

What are the most significant unanswered questions regarding ChlaDUB2 function and mechanism?

Despite progress in understanding ChlaDUB2, several critical questions remain that will shape future research directions:

  • Substrate specificity determinants:

    • What specific features of the ChlaDUB2 structure determine its preference for certain ubiquitin chain types?

    • How does substrate recognition differ between ChlaDUB1 and ChlaDUB2 despite their sequence similarity?

    • Are there additional post-translational modifications beyond ubiquitination that ChlaDUB2 might target?

  • Precise host targets:

    • Which specific host proteins are deubiquitinated by ChlaDUB2 during infection?

    • How does deubiquitination of these targets contribute to Golgi fragmentation mechanistically?

    • Are there tissue-specific targets that might explain tropism of different Chlamydia serovars?

  • Temporal regulation:

    • When precisely during the developmental cycle is ChlaDUB2 expressed and secreted?

    • What signals trigger ChlaDUB2 deployment into the host cytosol?

    • How is ChlaDUB2 activity regulated once inside the host cell?

  • Evolutionary significance:

    • Why has Chlamydia maintained separate DUB and dual DUB/AcT effectors rather than a single multifunctional protein?

    • What selective pressures drove the functional specialization of ChlaDUB2?

    • How do variations in ChlaDUB2 across Chlamydia species correlate with differences in pathogenesis?

  • Therapeutic potential:

    • Is ChlaDUB2 a viable target for anti-Chlamydial therapeutic development?

    • Can knowledge of ChlaDUB2 structure and function inform vaccine development strategies?

    • Would inhibition of ChlaDUB2 synergize with existing antibiotic treatments?

Addressing these questions will require integrative approaches combining structural biology, biochemistry, cell biology, and in vivo infection models. As genetic manipulation tools for Chlamydia continue to improve, targeted interrogation of ChlaDUB2 function in physiologically relevant contexts will become increasingly feasible.

What methodological advances would accelerate research on ChlaDUB2 and related bacterial effectors?

Accelerating research on ChlaDUB2 and related bacterial effectors requires several methodological innovations:

  • Improved genetic manipulation tools for Chlamydia:

    • Development of more efficient transformation protocols

    • Refinement of CRISPR-Cas9 systems adapted for Chlamydia

    • Creation of inducible expression systems for temporal control of effector production

    • Methods for site-specific integration of genes to ensure consistent expression levels

  • Advanced structural biology techniques:

    • Time-resolved cryo-EM to capture different states of the catalytic cycle

    • Integrative structural biology combining multiple techniques (crystallography, NMR, SAXS, HDX-MS)

    • Development of specific activity-based probes for tracking DUB activity in situ

    • Computational approaches for predicting protein-protein interactions based on structures

  • Systems-level analysis methods:

    • Single-cell approaches to measure heterogeneity in host response to ChlaDUB2

    • Quantitative proteomics workflows optimized for tracking ubiquitination dynamics

    • Spatial proteomics to map ChlaDUB2 activity within subcellular compartments

    • Network analysis tools to integrate multiple -omics datasets

  • Physiologically relevant infection models:

    • Three-dimensional tissue culture models mimicking natural infection sites

    • Microfluidic systems for controlled infection and real-time monitoring

    • Organoid cultures representing different tissue targets of Chlamydia

    • Improved animal models that better recapitulate human disease

  • High-throughput functional screening:

    • CRISPR screens to identify host factors required for ChlaDUB2 function

    • Small molecule libraries targeting specific aspects of ChlaDUB2 activity

    • Synthetic substrate libraries to precisely map specificity determinants

    • Automated image analysis pipelines for quantifying cellular phenotypes

These methodological advances would collectively address the current technical limitations that impede rapid progress in understanding ChlaDUB2 function. Particularly important is bridging the gap between in vitro biochemical characterization and in vivo relevance, which requires both improved infection models and more sophisticated tools for manipulating Chlamydia genes during infection .

How might insights from ChlaDUB2 research contribute to broader understanding of bacterial pathogenesis mechanisms?

Research on ChlaDUB2 has implications that extend beyond Chlamydia pathogenesis to enhance our understanding of fundamental principles in host-pathogen interactions:

  • Evolution of bacterial effector specialization:

    • ChlaDUB2's specialization as a dedicated DUB, in contrast to the dual-function ChlaDUB1, provides a model for studying effector diversification after gene duplication

    • This reveals how pathogens evolve specialized toolkits for manipulating host processes with precision

    • Understanding this evolutionary trajectory can inform predictions about effector functions in other bacterial systems

  • Ubiquitin system as a central battleground in infection:

    • The investment of Chlamydia in multiple effectors targeting the ubiquitin system underscores the critical importance of this pathway in host-pathogen interactions

    • ChlaDUB2 research reveals how pathogens have evolved sophisticated mechanisms to manipulate specific aspects of ubiquitin signaling

    • This highlights potential nodes of vulnerability in host defense that may be targeted by diverse pathogens

  • Principles of intracellular niche construction:

    • Chlamydia's manipulation of host cellular architecture through effectors like ChlaDUB2 demonstrates sophisticated strategies for creating optimal replication environments

    • The role of ChlaDUB2 in Golgi fragmentation reveals how pathogens can repurpose host organelles for their benefit

    • These insights apply to other intracellular pathogens that must similarly modify host environments

  • Coordination of bacterial effector networks:

    • The functional relationship between ChlaDUB1 and ChlaDUB2 illustrates how bacterial effectors operate as coordinated networks rather than isolated factors

    • This systems-level perspective is essential for understanding complex host-pathogen interactions

    • Similar principles likely apply across bacterial pathogens with type III secretion systems

  • Therapeutic strategy development:

    • Insights from ChlaDUB2's structure and mechanism can inform development of novel anti-virulence approaches

    • Understanding how bacterial effectors interface with host systems reveals potential targets for broad-spectrum therapies

    • The specialized nature of bacterial DUBs like ChlaDUB2 offers opportunities for pathogen-specific intervention strategies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.