Recombinant Chlamydia trachomatis serovar E Deubiquitinase and deneddylase Dub2 (cdu2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cdu2; SW2_8831; Deubiquitinase and deneddylase Dub2; ChlaDub2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Chlamydia trachomatis serovar E (strain Sweden2)
Target Names
cdu2
Target Protein Sequence
MEPIHNPPPQTCSYSRPSTTYTSFKDASCGTKVTRIIIALFLIVISCGLILCAYTFRDLL DADYSAQEGPQQATKLLQQLDKVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPL TKFNFLEYICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEHRCVTFFDSFYDYIASPQQMREQLEGLA ASLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Uniprot No.

Target Background

Function
Effector proteins modify host cell physiology, promoting bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities.
Database Links

KEGG: csw:SW2_8831

Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Q&A

What is Chlamydia trachomatis Deubiquitinase and deneddylase Dub2 (cdu2)?

Chlamydia trachomatis Deubiquitinase and deneddylase Dub2 (cdu2), also referred to as ChlaDUB2, is one of two cysteine proteases expressed by the obligate intracellular pathogen Chlamydia trachomatis that exhibits both deubiquitinating and deneddylating activity. Despite C. trachomatis having a relatively small genome, it expresses two distinct deubiquitinating enzymes (ChlaDUB1 and ChlaDUB2) that are released as bacterial effector proteins to manipulate host cell processes during infection . These enzymes are presumed to have somewhat redundant functions due to the similarity in their catalytic domains, but recent research has revealed important differences in their substrate specificity and enzymatic activity .

How does ChlaDUB2 differ from ChlaDUB1 in terms of enzymatic activity?

While both ChlaDUB1 and ChlaDUB2 share similar ability to cleave monoubiquitin-based substrates like ubiquitin aminomethylcoumarin (Ub-AMC), they exhibit distinct differences in their hydrolytic activity toward di- and polyubiquitin chains:

Substrate TypeChlaDUB1 ActivityChlaDUB2 Activity
Monoubiquitin (Ub-AMC)Efficient cleavageEfficient cleavage
DiubiquitinRapidly hydrolyzes (similar to SdeA)Unable to cleave efficiently
Polyubiquitinated GFPEfficiently disassembles into monoubiquitinShows substrate depletion but minimal monoubiquitin production

These differences suggest that while the distal ubiquitin binding is equivalent between the two enzymes (explaining similar Ub-AMC activity), ChlaDUB2's reduced efficiency with longer ubiquitinated substrates may be due to differential recognition involving additional ubiquitin binding sites .

What is the biological significance of ChlaDUB2 in Chlamydia trachomatis pathogenesis?

ChlaDUB2 plays a critical role in C. trachomatis survival and propagation within host cells. As an obligate intracellular bacterium, C. trachomatis must manipulate host cellular processes to establish its replicative niche. Biochemical studies have demonstrated that ChlaDUB2 shows preference for Lys-63 linked polyubiquitin chains, which are typically involved in signaling for lysosomal degradation . This substrate specificity suggests that ChlaDUB2 may protect the C. trachomatis-containing vacuole from Lys-63 induced lysosomal degradation, thereby supporting bacterial survival within the host cell . The enzyme's ability to modify host ubiquitination patterns likely contributes to immune evasion strategies and manipulation of host cellular functions during infection .

What are the optimal conditions for expressing and purifying recombinant ChlaDUB2?

For successful expression and purification of recombinant ChlaDUB2, researchers should consider the following methodological approach:

  • Cloning strategy: Design constructs that include the catalytic domain of ChlaDUB2, as this has been successfully used for structural and biochemical studies .

  • Expression system: E. coli-based expression systems have been effectively employed for ChlaDUB2 production. The protein should be expressed with appropriate affinity tags to facilitate purification.

  • Purification protocol:

    • Utilize affinity chromatography as the initial purification step

    • Follow with size exclusion chromatography to achieve high purity

    • Target purity levels of ≥85% as determined by SDS-PAGE analysis

  • Quality control: Verify protein activity using standard deubiquitinating enzyme assays with Ub-AMC substrate before proceeding to more complex experiments .

  • Storage conditions: Store purified enzyme in appropriate buffer conditions with glycerol at -80°C to maintain enzymatic activity.

This methodological approach has been validated in previous studies investigating the biochemical properties of ChlaDUB2 .

How should enzymatic assays be designed to accurately assess ChlaDUB2 activity?

When designing enzymatic assays to evaluate ChlaDUB2 activity, researchers should consider multiple substrate types and carefully control experimental conditions:

  • Substrate selection: Include various substrates to comprehensively assess activity:

    • Monoubiquitin-based substrates (e.g., Ub-AMC) for basic DUB activity

    • Defined linkage diubiquitin (particularly K48 and K63-linked) to assess linkage preference

    • Polyubiquitinated substrates (e.g., polyubiquitinated GFP) to evaluate activity on longer chains

  • Enzyme concentration optimization:

    • For diubiquitin substrates: Higher enzyme concentrations may be required as ChlaDUB2 shows reduced efficiency with these substrates

    • For polyubiquitinated substrates: Lower enzyme concentrations often yield better results

  • Time course experiments: ChlaDUB2 activity on polyubiquitinated substrates is often enhanced at shorter reaction times, so include multiple timepoints (e.g., 0, 5, 15, 30, 60 minutes)

  • Controls:

    • Include ChlaDUB1 as a positive control and comparative enzyme

    • Use catalytically inactive mutants as negative controls

    • Include commercial DUBs with known activity profiles as reference standards

  • Analysis methods:

    • SDS-PAGE followed by Western blotting for polyubiquitinated substrates

    • Fluorescence-based assays for Ub-AMC

    • HPLC or mass spectrometry for precise quantification of cleavage products

What are the key considerations for structural studies of ChlaDUB2?

When conducting structural studies of ChlaDUB2, researchers should address several critical factors:

  • Construct design:

    • Focus on the catalytic domain, which has previously yielded diffraction-quality crystals

    • Consider both apo-enzyme and enzyme-substrate complex constructs

    • Engineer constructs to remove flexible regions that might impede crystallization

  • Crystallization conditions:

    • Previous studies have successfully obtained ChlaDUB2 crystals that diffract, though phasing challenges have been reported

    • Co-crystallization with ubiquitin propargyl amide has yielded structures that reveal substrate recognition mechanisms

  • Structure determination approaches:

    • Molecular replacement using ChlaDUB1 as a template may be applicable due to catalytic domain similarities

    • Consider experimental phasing methods (heavy atom derivatives, selenomethionine incorporation) if molecular replacement fails

  • Comparative structural analysis:

    • Focus on residues involved in substrate recognition, which differ between ChlaDUB1 and ChlaDUB2

    • Analyze distal ubiquitin binding sites, which appear equivalent between the enzymes

    • Investigate potential additional ubiquitin binding sites that might explain differential activity on longer substrates

  • Complementary techniques:

    • Consider small-angle X-ray scattering (SAXS) to study enzyme-substrate complexes in solution

    • Employ hydrogen-deuterium exchange mass spectrometry to map protein-protein interaction surfaces

How do different serovars of C. trachomatis vary in ChlaDUB2 structure and function?

The evolutionary history and genomic diversity of C. trachomatis have significant implications for ChlaDUB2 structure and function across different serovars:

C. trachomatis has distinct biovars associated with different disease presentations (ocular, urogenital, and lymphogranuloma venereum) and comprises multiple serovars within each biovar . While the search results primarily discuss ChlaDUB2 from serovar A and L2b, comparative analysis across serovars reveals:

  • Sequence conservation and variation:

    • Core catalytic residues are highly conserved across serovars

    • Substrate recognition regions show more variability between serovars

    • These variations may contribute to serovar-specific host-pathogen interactions

  • Functional implications:

    • Despite sequence variations, the fundamental deubiquitinating and deneddylating activities appear to be maintained across serovars

    • Serovar-specific variations might fine-tune enzyme activity to optimize for different host cell environments and infection sites

  • Evolutionary significance:

    • Whole genome analyses of diverse C. trachomatis strains have revealed evidence of recombination both within and between biovars

    • Such recombination events may contribute to functional diversification of effector proteins including ChlaDUB2

Researchers studying serovar E ChlaDUB2 should specifically investigate any unique properties compared to the more extensively characterized serovar A and L2b variants .

What methodological approaches can resolve the apparent contradictions in ChlaDUB2 activity on polyubiquitinated substrates?

The literature reveals an interesting contradiction regarding ChlaDUB2 activity: while it shows depletion of polyubiquitinated substrates, it produces minimal monoubiquitin products compared to ChlaDUB1 . To resolve this apparent contradiction, researchers should consider the following methodological approaches:

  • Refined biochemical characterization:

    • Employ mass spectrometry to identify and quantify all cleavage products

    • Analyze reaction intermediates at multiple timepoints using high-resolution techniques

    • Test activity on synthetic defined-length polyubiquitin chains of various linkage types

  • Alternative mechanisms to explore:

    • Investigate whether ChlaDUB2 might cleave within polyubiquitin chains rather than at the substrate-proximal end

    • Examine if ChlaDUB2 shows preferential activity toward specific ubiquitin chain lengths

    • Consider if substrate proteins themselves influence the deubiquitinating activity

  • Structural approaches:

    • Conduct crystallographic studies of ChlaDUB2 bound to di- or tri-ubiquitin chains

    • Use site-directed mutagenesis to probe the role of specific residues in polyubiquitin recognition

    • Apply computational modeling to predict polyubiquitin binding modes

  • Experimental design considerations:

    • Control for enzyme concentration effects, as ChlaDUB2's activity on polyubiquitinated substrates is more pronounced at lower concentrations

    • Implement time-course experiments with high temporal resolution

    • Use fluorescently labeled ubiquitin to track product formation in real-time

How can researchers design experiments to elucidate the physiological role of ChlaDUB2 in C. trachomatis infection?

To investigate the physiological role of ChlaDUB2 during C. trachomatis infection, researchers should design comprehensive experiments that bridge biochemical findings with cellular and infection models:

  • Cellular localization studies:

    • Track the spatiotemporal localization of ChlaDUB2 during the C. trachomatis developmental cycle

    • Determine if ChlaDUB2 associates with specific cellular compartments or host proteins

    • Use fluorescently tagged ChlaDUB2 in live-cell imaging experiments

  • Host-pathogen interaction analysis:

    • Identify host protein targets of ChlaDUB2 using proximity labeling approaches

    • Perform immunoprecipitation followed by mass spectrometry to identify binding partners

    • Characterize changes in the host ubiquitinome during infection using proteomics

  • Functional validation experiments:

    • Create catalytically inactive ChlaDUB2 mutants and assess their impact on C. trachomatis growth

    • Develop conditional expression systems to modulate ChlaDUB2 levels during infection

    • Design cell lines expressing ChlaDUB2-specific inhibitors under inducible control

  • Comparative studies across serovars:

    • Assess whether serovar-specific variations in ChlaDUB2 correlate with differences in infection dynamics

    • Compare ChlaDUB2 activity in ocular versus urogenital serovars in relevant cell types

  • In vivo relevance:

    • Design animal infection models with wild-type versus mutant C. trachomatis strains

    • Develop tissue-specific approaches to study ChlaDUB2 function in different infection sites

Experimental ApproachKey MeasurementsExpected Outcomes
Cellular infection modelsBacterial replication, inclusion morphologyDetermine ChlaDUB2's impact on bacterial fitness
Ubiquitinome analysisChanges in host protein ubiquitinationIdentify physiological targets of ChlaDUB2
Immune response assaysCytokine production, immune cell recruitmentAssess ChlaDUB2's role in immune evasion
Drug inhibition studiesEffects of specific DUB inhibitorsEvaluate ChlaDUB2 as a therapeutic target

What are the critical quality control parameters for recombinant ChlaDUB2 in experimental studies?

Ensuring consistent quality of recombinant ChlaDUB2 preparations is essential for reliable experimental outcomes. Researchers should implement the following quality control parameters:

  • Purity assessment:

    • Target ≥85% purity as determined by SDS-PAGE and densitometry analysis

    • Verify absence of contaminating proteases that could confound activity assays

    • Consider additional purification steps if required purity is not achieved

  • Activity validation:

    • Conduct standard Ub-AMC assays to confirm enzymatic activity

    • Compare activity to reference standards or previous preparations

    • Establish specific activity values (activity units per mg protein)

  • Structural integrity:

    • Use circular dichroism spectroscopy to verify proper protein folding

    • Employ thermal shift assays to assess protein stability

    • Consider limited proteolysis to confirm structural integrity

  • Storage stability:

    • Determine optimal buffer conditions for long-term storage

    • Assess activity retention after freeze-thaw cycles

    • Establish maximum storage duration guidelines

  • Batch consistency:

    • Implement standardized production and testing protocols

    • Maintain reference samples from validated batches

    • Document lot-to-lot variation in critical parameters

How can researchers address the challenges in structure determination of ChlaDUB2?

Previous studies have encountered challenges in structure determination of ChlaDUB2, particularly in phasing diffraction data . To overcome these challenges, researchers should consider the following approaches:

  • Crystal optimization strategies:

    • Screen multiple constructs with varying N- and C-terminal boundaries

    • Employ surface entropy reduction mutations to promote crystal contacts

    • Test co-crystallization with various substrate analogs or inhibitors

  • Phasing solutions:

    • Prepare selenomethionine-labeled protein for single-wavelength anomalous dispersion (SAD)

    • Generate heavy atom derivatives for multiple isomorphous replacement (MIR)

    • Use molecular replacement with ChlaDUB1 structure as a search model, accounting for differences

  • Alternative structural approaches:

    • Consider cryo-electron microscopy for larger complexes

    • Employ NMR spectroscopy for structural characterization in solution

    • Use integrative structural biology approaches combining multiple data types

  • Data collection strategies:

    • Collect multiple datasets from different crystals to improve phasing power

    • Consider micro-focus beamlines for small or poorly diffracting crystals

    • Implement helical data collection for radiation-sensitive crystals

  • Computational methods:

    • Apply advanced molecular replacement protocols with distantly related search models

    • Consider ab initio phasing methods for challenging cases

    • Utilize fragment-based molecular replacement when applicable

What experimental design principles enable accurate comparative analysis of ChlaDUB1 versus ChlaDUB2?

To conduct rigorous comparative analysis of ChlaDUB1 and ChlaDUB2, researchers should adhere to the following experimental design principles:

  • Standardized production methods:

    • Express and purify both enzymes using identical systems and protocols

    • Verify equivalent purity and structural integrity

    • Prepare both enzymes simultaneously to minimize batch effects

  • Activity normalization approaches:

    • Calibrate enzyme concentrations based on active site titration

    • Normalize activity using a standard substrate (e.g., Ub-AMC)

    • Perform dose-response experiments across a range of enzyme concentrations

  • Comprehensive substrate panel:

    • Test both enzymes against identical substrate sets including:

      • Monoubiquitin-based substrates

      • All seven lysine-linked diubiquitin types (K6, K11, K27, K29, K33, K48, K63)

      • Met1-linked (linear) diubiquitin

      • Polyubiquitinated model proteins with defined linkages

      • Nedd8-based substrates to assess deneddylase activity

  • Controlled reaction conditions:

    • Maintain identical buffer components, pH, temperature, and ionic strength

    • Implement consistent time points for kinetic analysis

    • Include internal controls in each experiment

  • Rigorous data analysis:

    • Apply appropriate statistical methods for comparing kinetic parameters

    • Consider global data fitting approaches for complex datasets

    • Quantify both substrate depletion and product formation rates

How might ChlaDUB2 serve as a target for novel anti-chlamydial therapeutics?

Based on current understanding of ChlaDUB2's role in C. trachomatis pathogenesis, several promising approaches for therapeutic development can be proposed:

  • Structure-based inhibitor design:

    • Utilize the crystal structures of ChlaDUB2 and its complex with ubiquitin propargyl amide to design specific inhibitors

    • Target unique structural features that distinguish ChlaDUB2 from human DUBs to enhance selectivity

    • Consider covalent inhibitors targeting the catalytic cysteine residue

  • Dual-targeting strategies:

    • Develop compounds that simultaneously inhibit both ChlaDUB1 and ChlaDUB2 to overcome potential functional redundancy

    • Design inhibitors that target conserved features between the two enzymes

  • Host-directed therapy approaches:

    • Identify and target host factors that interact with ChlaDUB2

    • Modulate host ubiquitination pathways to counteract ChlaDUB2 effects

  • Delivery considerations:

    • Develop strategies to deliver inhibitors to the intracellular bacterial compartment

    • Explore cell-penetrating peptides or nanoparticle formulations to enhance delivery

  • Validation experiments:

    • Test candidate inhibitors in cellular infection models

    • Evaluate effects on bacterial replication, inclusion morphology, and host response

    • Assess potential for resistance development

What are the most promising approaches for investigating the evolution of deubiquitinating enzymes across Chlamydia species?

Understanding the evolutionary history of deubiquitinating enzymes in Chlamydia provides valuable insights into pathogen adaptation and host-pathogen interactions:

  • Comparative genomic analyses:

    • Sequence ChlaDUB homologs across diverse Chlamydia species and strains

    • Apply phylogenetic methods to reconstruct evolutionary relationships

    • Identify signatures of positive selection and recombination events

  • Functional evolution studies:

    • Express and characterize DUBs from evolutionarily diverse Chlamydia species

    • Compare substrate preferences and catalytic efficiencies

    • Correlate enzymatic properties with host range and tissue tropism

  • Host adaptation analysis:

    • Investigate how ChlaDUB enzymes have evolved to target specific host ubiquitination pathways

    • Study co-evolution of bacterial DUBs with host ubiquitin systems

    • Examine whether different host species exert distinct selective pressures

  • Structural biology approaches:

    • Determine structures of ChlaDUB enzymes from multiple species

    • Map evolutionary changes onto structural models

    • Identify conserved and variable structural elements

  • Experimental evolution:

    • Subject C. trachomatis to selective pressures in laboratory settings

    • Monitor changes in ChlaDUB sequences and functions over multiple generations

    • Test whether environmental conditions drive adaptive changes in DUB activity

What methodological innovations could advance our understanding of ChlaDUB2's role in host-pathogen interactions?

Several cutting-edge methodological approaches could significantly enhance our understanding of ChlaDUB2's biological functions:

  • Advanced imaging techniques:

    • Apply super-resolution microscopy to visualize ChlaDUB2 localization during infection

    • Use correlative light and electron microscopy to link enzyme localization with cellular ultrastructure

    • Implement live-cell imaging with genetically encoded ubiquitin sensors

  • CRISPR-based approaches:

    • Develop CRISPR interference systems for conditional knockdown in Chlamydia

    • Use CRISPRa/i screens to identify host factors that interact with ChlaDUB2

    • Apply base editing to introduce specific mutations in ChlaDUB2

  • Proximity labeling proteomics:

    • Fuse ChlaDUB2 with BioID, APEX, or TurboID for in situ identification of interacting proteins

    • Map the temporal dynamics of ChlaDUB2 interactions during the infection cycle

    • Identify substrates through quantitative proteomics comparing wild-type and catalytically inactive mutants

  • Single-cell approaches:

    • Apply single-cell transcriptomics to infected cells expressing or lacking ChlaDUB2

    • Use single-cell proteomics to characterize heterogeneity in host response

    • Implement microfluidic systems to track infection dynamics at single-cell resolution

  • Systems biology integration:

    • Develop computational models of host ubiquitination networks during infection

    • Integrate multi-omics data to predict ChlaDUB2 effects on cellular pathways

    • Apply machine learning to identify patterns in host response to ChlaDUB2 activity

Methodological ApproachKey AdvantagesResearch Applications
Proximity labelingIdentifies transient interactions in native contextSubstrate and partner discovery
CRISPR-based toolsEnables precise genetic manipulationFunctional validation studies
Single-cell technologiesCaptures cellular heterogeneityHost response characterization
Advanced imagingProvides spatiotemporal informationMechanism of action studies
Systems modelingIntegrates diverse datasetsPrediction of therapeutic targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.