Recombinant Chlamydia trachomatis serovar G Inclusion membrane protein A (incA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize developing your specified tag.
Synonyms
incA; CTG9301_00615; Inclusion membrane protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Chlamydia trachomatis serovar G (strain G/9301)
Target Names
incA
Target Protein Sequence
MTTPTLIVTPPSPPAPSYSANRVPQPSLMDKIKKIAAIASLILIGTIGFLALLGHLVGFL IAPQITIVLLALFIISLAGNALYLQKTANLHLYQDLQREVGSLKEINFMLSVLQKEFLHL SKEFATTSKDLSAVSQDFYSCLQGFRDNYKGFESLLDEYKNSTEEMRKLFSQEIIADLKG SVASLREEIRFLTPLAEEVRRLAHNQQSLTVVIEELKTIRDSLRDEIGQLSQLSKTLTSQ IALQRKESSDLCSQIRETLSSPRKSASPSTKSS
Uniprot No.

Target Background

Function
Chlamydia replicates within an intracellular vacuole known as an inclusion. IncA is likely involved in the homotypic fusion of inclusions.
Database Links
Subcellular Location
Secreted. Host vacuole, host pathogen-containing vacuole, host pathogen-containing vacuole membrane; Multi-pass membrane protein.

Q&A

What is IncA and what is its structural and functional significance in Chlamydia trachomatis?

IncA is a prototypical inclusion membrane protein produced by Chlamydia trachomatis during infection. Structurally, IncA contains two extended 3,4-hydrophobic heptad repeat segments similar to the coiled-coil regions of eukaryotic SNARE (soluble N-ethylmaleimide-sensitive factor attachment receptor) proteins . The atomic structure of IncA's cytoplasmic domain reveals a non-canonical four-helix bundle that is essential for its function .

Functionally, IncA enhances C. trachomatis pathogenicity by promoting homotypic fusion of inclusions in multiply infected cells . This fusion capability creates a unified replicative niche that facilitates bacterial development. IncA has been shown to localize specifically to the chlamydial inclusion membrane and not the intracellular bacteria themselves . Importantly, naturally occurring IncA-negative clinical isolates form non-fusogenic inclusions and are associated with altered pathogenicity profiles .

Recent structural studies have identified an intramolecular clamp in IncA that is essential for its membrane fusion activity during infection , making it a key component in understanding chlamydial host-pathogen interactions.

How does IncA expression vary among different Chlamydia species and serovars?

Biovar/SpeciesSerovarsIncA ExpressionMYPT1 Recruitment
C. trachomatis TrachomaA, B, Ba, CPositiveYes (except B/Jali20)
C. trachomatis OculogenitalD, Da, D-, E, F, G, H, I, Ia, I-, J, KPositiveYes
C. trachomatis LGVL1, L2, L2a, L3PositiveYes
C. muridarum-PresentYes
C. caviae-PresentNo
C. pneumoniae-PresentNo
C. psittaci GPIC-Different formNot determined

Notably, serovar B/Jali20 encodes a truncated form of CT228 and does not detectably express CT228, which impacts host protein (MYPT1) recruitment to the inclusion membrane . This demonstrates that variations in Inc proteins between serovars and species can significantly alter host-pathogen interactions.

Some naturally occurring clinical isolates of C. trachomatis lack IncA expression despite having the incA gene. These IncA-negative strains typically harbor mutations that prevent proper protein expression and result in non-fusogenic inclusions .

What methods can be used to detect and quantify IncA expression in laboratory settings?

Several established methods are effective for detecting and quantifying IncA expression:

Immunofluorescence Microscopy:

  • Fix infected cells at desired time points post-infection

  • Label with primary antibodies against IncA (polyclonal rabbit anti-IncA antibodies are commonly used)

  • Add secondary antibodies conjugated with fluorophores

  • Counter-stain with markers for bacterial organisms (anti-MOMP) or inclusion membrane proteins (14-3-3β)

  • This technique allows visualization of IncA's specific localization to the inclusion membrane

Western Blotting:

  • Harvest infected cells at appropriate time points

  • Perform protein extraction and quantification

  • Separate proteins using SDS-PAGE

  • Transfer to membrane and probe with anti-IncA antibodies

  • This method confirms IncA production and can detect truncated forms or absence of protein

PCR/RT-PCR:

  • Extract RNA from infected cells

  • Perform reverse transcription to generate cDNA

  • Amplify incA gene segments using specific primers

  • Enables detection of transcriptional changes and can identify mutations

Temporal Expression Analysis:
Research has shown that IncA transcription and protein expression can be detected as early as 4 hours after the start of infection , making early time-point sampling important for comprehensive studies.

How can researchers insertionally inactivate incA in C. trachomatis and what controls are necessary?

The group II intron-based approach has proven effective for selectable site-specific inactivation of incA:

Methodology:

  • Modify the TargeTron™ system (commercially available from Sigma) for use in C. trachomatis by altering DNA sequences within the intron's substrate recognition region

  • Design the construct to insertionally inactivate incA by introducing a group II intron carrying a beta-lactamase (bla) marker: incA::GII(bla)

  • Transform C. trachomatis with the modified TargeTron™ construct

  • Select transformants using ampicillin resistance conferred by the bla marker

  • Isolate individual clones through plaque purification

Verification and Controls:

  • Confirm insertion using PCR amplification across the insertion site

  • Verify by Southern blotting to confirm single integration

  • Sequence the insertion site to confirm exact location

  • Assess stability through continuous passage without selection pressure

  • Conduct Western blot analysis to verify absence of IncA protein

  • Perform immunofluorescence microscopy to confirm non-fusogenic inclusion phenotype

An essential control is complementation of the mutant to confirm phenotype attribution to IncA loss. Researchers have implemented complementation systems to express wild-type or modified IncA, demonstrating that a functional core composed of SNARE-like domain 1 (SLD-1) and part of SNARE-like domain 2 (SLD-2) is required for homotypic fusion .

What is the phenotypic significance of IncA-negative strains and how do they differ from wild-type strains?

IncA-negative strains display several important phenotypic differences:

Inclusion Morphology:

  • Form non-fusogenic inclusions in cells infected at a multiplicity of infection greater than one

  • Multiple inclusions remain separate rather than fusing into a single large inclusion

  • This phenotype can be observed by light and immunofluorescence microscopy

Molecular Characteristics:
Three distinct types of IncA-negative populations have been identified:

  • Strains with translational inactivation of incA (first step)

  • Strains with decreased transcript levels

  • Strains with genomic sequence differences (over 5,000 nucleotide polymorphisms have been observed in some IncA-negative strains compared to serovar-matched wild-type strains)

Growth Characteristics:

  • IncA-negative strains isolated in the presence of serovar-matched wild-type strains phenotypically resemble the wild-type more closely than IncA-negative strains isolated independently

  • Differences in growth rates in vitro have been documented

  • Mouse infectivity patterns differ between IncA-negative and wild-type strains

Clinical Relevance:
IncA-negative strains have been associated with milder, subclinical infections in patients , suggesting that IncA's role in homotypic fusion contributes to pathogenicity.

What host proteins interact with IncA and what methods can be used to identify these interactions?

Several host proteins interact with IncA or other inclusion membrane proteins:

Known Interacting Proteins:

  • MYPT1 (Myosin phosphatase target subunit 1) - recruited to the inclusion membrane through interaction with CT228, another inclusion membrane protein

  • 14-3-3β - recruited to the inclusion membrane through interaction with IncG

  • SNX5 and SNX6 (Sorting Nexin proteins) - interact with IncE, another Inc protein that affects membrane deformation and tubulation

Methods to Identify Protein Interactions:

  • Co-immunoprecipitation:

    • Lyse infected cells

    • Precipitate using antibodies against IncA

    • Identify co-precipitating host proteins by mass spectrometry or Western blotting

  • Yeast Two-Hybrid Screening:

    • Use IncA as bait protein

    • Screen against human cDNA libraries

    • Validate positive interactions with secondary assays

  • Fluorescence Microscopy Co-localization:

    • Express fluorescently tagged versions of IncA and candidate host proteins

    • Observe co-localization in infected cells

    • Example: N-terminal mCherry fusion of full-length MYPT1 was expressed in C. trachomatis-infected cells to confirm recruitment to the inclusion membrane

  • Protein Affinity Purification:

    • Express recombinant IncA with affinity tags

    • Incubate with host cell lysates

    • Identify bound proteins through mass spectrometry

These interaction studies are critical for understanding how Chlamydia modifies its intracellular environment to evade host defenses and acquire nutrients.

What is the molecular mechanism of IncA-mediated homotypic fusion of inclusions?

The molecular mechanism of IncA-mediated homotypic fusion involves several key structural elements:

Structural Basis:

  • IncA contains a functional core composed of SNARE-like domain 1 (SLD-1) and part of SNARE-like domain 2 (SLD-2)

  • The atomic structure reveals a non-canonical four-helix bundle unlike conventional SNARE proteins

  • An intramolecular clamp has been identified as essential for IncA-mediated membrane fusion

Fusion Mechanism:

  • IncA molecules in opposing inclusion membranes interact through their SNARE-like domains

  • The intramolecular clamp provides stability during the fusion process

  • This interaction promotes membrane destabilization and lipid mixing between inclusions

  • Complete fusion results in a single, unified inclusion compartment

Experimental Support:
Structure-based mutagenesis, molecular dynamics simulation, and functional cellular assays have identified critical residues within the intramolecular clamp that are essential for IncA-mediated homotypic membrane fusion during infection . Mutations in these regions abolish fusion capacity without affecting protein expression or localization.

Research has shown that naturally occurring clinical isolates with incA mutations that disrupt SNARE-like domains result in non-fusogenic phenotypes , further supporting the direct role of these domains in the fusion process.

How can recombinant IncA be utilized in diagnostic applications and vaccine development?

Recombinant IncA offers significant potential for both diagnostic and vaccine applications:

Diagnostic Applications:

  • Antigen Detection Systems:

    • IncA antigen has been detected in urine samples from infected patients

    • Recombinant IncA could be used to develop standardized antibodies for sensitive antigen capture assays

    • This approach could improve non-invasive testing methods

  • Antibody Detection:

    • Patient sera recognize IncA, indicating it is immunogenic during natural infection

    • ELISA assays using recombinant IncA could detect antibody responses in:

      • Urine samples

      • Genital swab samples

      • Serum samples

Vaccine Development Potential:

  • Immunogenicity:

    • IncA produces detectable antibody responses in naturally infected humans

    • Similar responses were observed in experimentally infected monkeys

    • The early expression (4 hours post-infection) makes it an attractive target

  • Vaccine Strategies:

    • Recombinant IncA could be used as a subunit vaccine component

    • Expression of IncA in viral vectors could generate cell-mediated responses

    • DNA vaccines encoding IncA could elicit both humoral and cellular immunity

  • Challenges:

    • Potential sequence variation between serovars may affect cross-protection

    • Need to determine protective vs. non-protective epitopes

    • Requirement for appropriate adjuvants to direct immune responses

The timing of IncA expression (as early as 4 hours post-infection) makes it particularly attractive as both a diagnostic marker and vaccine antigen, potentially allowing for detection and targeting of early infection stages .

What methodological approaches can be used to study the functional domains of IncA protein?

Several complementary approaches can elucidate IncA's functional domains:

Structure-Based Mutagenesis:

  • Generate point mutations in key residues based on structural analysis

  • Create deletion mutants of specific domains (SLD-1, SLD-2, etc.)

  • Construct chimeric proteins containing domains from different Inc proteins

  • Express these constructs in IncA-negative strains to assess complementation

Protein Biochemistry:

  • Express and purify full-length and truncated recombinant IncA

  • Perform circular dichroism to assess secondary structure

  • Use size exclusion chromatography to determine oligomerization states

  • Conduct thermal shift assays to evaluate protein stability

  • Employ liposome fusion assays to directly test membrane fusion activity in vitro

Microscopy-Based Functional Assays:

  • Express fluorescently tagged IncA variants in infected cells

  • Quantify inclusion fusion rates with time-lapse microscopy

  • Measure protein dynamics using FRAP (Fluorescence Recovery After Photobleaching)

  • Apply super-resolution microscopy to visualize IncA organization at the inclusion membrane

Computational Approaches:

  • Conduct molecular dynamics simulations to study IncA conformational changes

  • Predict interaction interfaces using docking simulations

  • Perform sequence-based evolutionary analysis to identify conserved functional motifs

Research has demonstrated that a functional core composed of SNARE-like domain 1 (SLD-1) and part of SNARE-like domain 2 (SLD-2) is required for promoting homotypic fusion in C. trachomatis . This finding was established through the implementation of a complementation system that allowed researchers to test various truncated or mutated forms of IncA.

How do IncA-negative clinical isolates emerge and what evolutionary advantages might they confer?

The emergence and potential advantages of IncA-negative strains involve complex mechanisms:

Emergence Mechanisms:

  • Multistep Process:

    • Initial translational inactivation of incA appears to be the first step

    • Subsequent changes lead to decreased transcript levels

    • Additional genomic adaptations follow over time

  • Mixed Infections:

    • Clinical samples have been identified containing mixtures of IncA-positive and IncA-negative same-serovar C. trachomatis populations

    • Serial isolates from persistently infected individuals show evidence of IncA-positive to IncA-negative transitions

  • Genetic Variations:

    • Some strains have mutations that directly affect the incA coding sequence

    • Others have intact incA genes but fail to express the protein

    • The serovar B/Jali20 strain encodes a truncated form of CT228 that affects IncA function

Potential Evolutionary Advantages:

  • Immune Evasion:

    • Non-fusogenic inclusions may present different antigenic profiles

    • Multiple smaller inclusions might be less efficiently targeted by immune responses

    • IncA is immunogenic; its absence may reduce recognition by adaptive immunity

  • Persistence Mechanisms:

    • IncA-negative strains have been associated with milder, potentially more persistent infections

    • Lower growth rates may facilitate long-term survival within the host

    • Different nutrient acquisition patterns could enable adaptation to specific niches

  • Transmission Dynamics:

    • Subclinical infections caused by IncA-negative strains may go undetected and untreated

    • This could potentially increase transmission opportunities over time

What are the optimal methods for producing and purifying recombinant IncA protein?

Producing high-quality recombinant IncA requires specialized approaches due to its membrane-associated nature:

Expression Systems:

  • E. coli-Based Expression:

    • Use BL21(DE3) or similar strains optimized for protein expression

    • Express as fusion proteins with solubility tags such as:

      • MBP (Maltose-Binding Protein) - previously used successfully for IncA

      • SUMO tag

      • Thioredoxin

    • Consider codon optimization for prokaryotic expression

    • Use autoinduction media to enhance yield while reducing toxicity

  • Cell-Free Expression Systems:

    • Particularly useful for membrane proteins

    • Allows immediate incorporation into artificial liposomes

    • Reduces toxicity issues associated with membrane protein overexpression

  • Eukaryotic Expression:

    • Insect cell/baculovirus systems for proper folding

    • Mammalian cell expression for authentic post-translational modifications

Purification Strategy:

  • For Full-Length IncA:

    • Detergent extraction (DDM, CHAPS, or OG) from membrane fractions

    • Affinity chromatography using His-tag or fusion partner

    • Size exclusion chromatography to remove aggregates

    • Consider amphipol or nanodisc reconstitution for stability

  • For Cytoplasmic Domain:

    • Direct affinity purification from soluble fraction

    • Ion exchange chromatography to enhance purity

    • Size exclusion chromatography for final polishing

Quality Control Assessments:

  • Circular dichroism to confirm secondary structure

  • Dynamic light scattering to assess homogeneity

  • Thermal shift assays to evaluate stability

  • Functional validation through liposome fusion assays

For structural studies, the cytoplasmic domain of IncA has been successfully expressed and purified, enabling determination of its atomic structure revealing a non-canonical four-helix bundle .

How can isotopically non-stationary metabolic flux analysis (INST-MFA) be applied to study Chlamydia metabolism in the context of IncA function?

INST-MFA can provide valuable insights into metabolic changes associated with IncA expression or deletion:

Principles and Application:

  • INST-MFA uses tracer experiments where 13C labeling measurements are collected before reaching isotopic steady state

  • This approach is particularly suitable for Chlamydia which has a complex developmental cycle with changing metabolic states

Experimental Design for Chlamydia Studies:

  • Infection Model Setup:

    • Compare wild-type C. trachomatis with incA::GII(bla) mutants

    • Infect host cells (typically HeLa) at controlled MOI

    • Add isotopically labeled substrates (e.g., [U-13C]glucose) at specific time points

  • Sampling Strategy:

    • Collect samples at multiple time points across the developmental cycle

    • Separate chlamydial forms from host cells when possible

    • Extract metabolites using optimized protocols for intracellular pathogens

  • Measurement Techniques:

    • GC-MS or LC-MS/MS to quantify isotopic enrichment in metabolites

    • Target key metabolic intermediates in central carbon metabolism

    • Measure extracellular exchange rates of nutrients and by-products

Data Analysis Using INCA Platform:
The INCA (Isotopomer Network Compartmental Analysis) software package is specifically designed for INST-MFA calculations :

  • Network Definition:

    • Specify reaction stoichiometry, compartmentation, and atom transitions

    • Define the metabolic network including host-pathogen nutrient exchange

  • Model Analysis:

    • Constraint-based analysis to assess network properties

    • Simulate isotopomer distributions based on tracer inputs

    • Identify optimal experimental designs before conducting experiments

  • Parameter Estimation:

    • Minimize the sum-of-squared residuals between simulated and experimental measurements

    • Use multiple starting points to ensure global optimum

    • Calculate confidence intervals using Monte Carlo analysis

This approach can reveal how IncA affects nutrient acquisition pathways, identifying metabolic adaptations that occur in fusion-incompetent mutants and potentially explaining growth differences between wild-type and IncA-negative strains .

What are the latest developments in genetic manipulation techniques applicable to studying IncA function in Chlamydia?

Recent advances have expanded the genetic toolkit for Chlamydia research:

Site-Specific Gene Inactivation:

  • Group II Intron (TargeTron™) System:

    • Successfully used to insertionally inactivate incA

    • Selection with ampicillin via beta-lactamase marker

    • Advantages: stable without selection, targetable to specific sites

    • Limitations: polar effects on downstream genes possible

  • CRISPR/Cas9 Approaches:

    • Emerging technology for Chlamydia

    • Potential for scarless mutations and precise editing

    • Requires optimization for the chlamydial intracellular environment

Complementation Systems:

  • Plasmid-Based Expression:

    • Essential for confirming phenotype attribution

    • Can express wild-type or modified IncA variants

    • Used to demonstrate the requirement for a functional core of IncA

  • Chromosomal Integration:

    • More stable expression without selection pressure

    • Better mimics natural expression levels

Expression Control Systems:

  • Inducible Promoters:

    • Allow temporal control of gene expression

    • Useful for studying toxic proteins or determining timing effects

  • Fluorescent Reporters:

    • Fusion constructs to monitor localization and expression

    • Used to visualize recruitment patterns of host proteins

Emerging Technologies:

  • Chemical Mutagenesis:

    • Generation of random mutants for forward genetic screens

    • Used successfully to identify chlamydial virulence factors

  • Transposon Mutagenesis:

    • Being adapted for use in Chlamydia

    • Potential for large-scale mutant libraries

  • Single-Cell Analysis:

    • Microfluidic systems to study individual infected cells

    • Combines with fluorescent reporters for real-time monitoring

These techniques have transformed Chlamydia from a genetically intractable organism to one where sophisticated genetic manipulations are increasingly possible, enabling more detailed studies of IncA function and other virulence factors.

What are the emerging questions and research opportunities regarding IncA structure-function relationships?

Several promising research directions could advance our understanding of IncA:

Structural Biology Frontiers:

  • Complete Structural Characterization:

    • Determine high-resolution structures of full-length IncA including transmembrane domains

    • Elucidate conformational changes during membrane fusion

    • Map the complete binding interface between opposing IncA molecules

  • Dynamic Structural Analysis:

    • Apply cryo-electron tomography to visualize IncA in situ on inclusion membranes

    • Use single-molecule approaches to study conformational dynamics

    • Develop biosensors to monitor IncA activity in real-time during infection

Functional Expansion:

  • Beyond Fusion - Additional Roles:

    • Investigate potential roles in nutrient acquisition across the inclusion membrane

    • Explore interactions with host signaling pathways

    • Examine potential roles in immune evasion

  • Serovar-Specific Functions:

    • Compare IncA functions across different C. trachomatis serovars

    • Identify correlations between IncA sequence variations and tissue tropism

    • Determine if IncA contributes to the distinct pathogenic profiles of ocular, genital, and LGV strains

Therapeutic Targeting:

  • Inhibitor Development:

    • Design small molecules targeting the intramolecular clamp essential for fusion

    • Develop peptide inhibitors that disrupt IncA-IncA interactions

    • Explore antibody-based approaches to neutralize IncA function

  • Vaccine Strategies:

    • Determine if antibodies against specific IncA domains can neutralize infection

    • Identify T cell epitopes for cell-mediated immunity

    • Develop multi-component vaccines incorporating IncA with other antigens

These research directions could lead to novel therapeutic strategies targeting this essential virulence factor while expanding our fundamental understanding of bacterial membrane fusion mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.