Recombinant Chlamydia trachomatis serovar L2 Deubiquitinase and deneddylase Dub1 (cdu1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
cdu1; CTL0247; Deubiquitinase and deneddylase Dub1; ChlaDub1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)
Target Names
cdu1
Target Protein Sequence
MLSPTNSTSKTAPVPPRDSSKPVLISEEPRNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTHPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSTPSAPKPSTP PPLLPKAPKPVKTQEDLLPLVPEQVFVEMYEDMARRQTIEALVPAWDSDIIFKCLCYFHT LYPGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGPLPICCSKENYRRHLQRTT LLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARRLVYFDSLYNYVMP PENMKKELQSFAQQLDQVYPAYDSKKFSVKIAAKEVIQRGSGSSCGAWCCQFLHWYLKDP LTDALNDLPVDSVERHENLASFVQACEAAVQDLPELSWPEA
Uniprot No.

Target Background

Function

Recombinant Chlamydia trachomatis serovar L2 Deubiquitinase and Deneddylase Dub1 (cdu1)

Effector proteins modulate host cell physiology, enhancing bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities. It impairs the ubiquitination and degradation of NF-κB inhibitor alpha (NFKBIA), thus preventing NF-κB activation.

Database Links

KEGG: ctb:CTL0247

Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein. Note=Secreted, and delivered into the host cell. Located predominantly on the plasma membrane and to a lesser extent on intracellular membranes, especially the host cell nuclear envelope.

Q&A

What is the structural organization of Cdu1 and how does it compare to eukaryotic deubiquitinases?

Cdu1 exhibits remarkable structural similarity to mammalian deubiquitinases while maintaining unique features specific to chlamydial pathogenesis. Structural analyses reveal that Cdu1 possesses a catalytic domain with high similarity to eukaryotic deubiquitinases, suggesting evolutionary convergence or possible horizontal gene transfer . Notably, Cdu1 contains a distinctive α-helix positioned proximal to the substrate-binding pocket, which differentiates it from mammalian counterparts and likely contributes to substrate specificity . The enzyme features an N-terminal transmembrane domain that anchors it to the inclusion membrane with the catalytic domain facing the host cytosol, enabling interaction with host substrates .

What are the confirmed enzymatic activities of Cdu1?

Cdu1 demonstrates dual enzymatic capabilities that contribute to chlamydial pathogenesis:

  • Deubiquitinase (DUB) activity: Cdu1 cleaves ubiquitin from target proteins, including host anti-apoptotic regulator Mcl-1, preventing its proteasomal degradation .

  • Lysine acetyltransferase activity: Recent research has established that Cdu1 possesses acetyltransferase activity that protects itself from ubiquitin-mediated degradation . This activity is also important for protecting other chlamydial proteins (InaC, IpaM, and CTL0480) from degradation after secretion into the host cell .

The relationship between these two activities appears hierarchical, with the acetyltransferase activity being essential for maintaining Cdu1 stability, which subsequently enables its deubiquitinase functions.

What is the intracellular localization pattern of Cdu1 during infection?

Cdu1 exhibits a dynamic localization pattern during the chlamydial developmental cycle. Immunofluorescence microscopy using anti-Cdu1 antibodies has demonstrated that Cdu1 localizes primarily to two distinct sites:

  • Inclusion membrane: Major amounts of Cdu1 are detected at the surface of the inclusion, co-localizing with the inclusion membrane protein IncA . This localization is facilitated by its N-terminal transmembrane domain.

  • Within bacterial particles: Cdu1 is also detected inside the inclusion, associated with bacterial particles .

Importantly, contrary to earlier reports suggesting cytoplasmic distribution, rigorous immunolocalization studies using FLAG-tagged recombinant Cdu1 confirmed that the protein is not detected in the host cell cytoplasm . The C-terminal catalytic domain of Cdu1 faces the host cytosol, allowing interaction with host substrates while remaining anchored to the inclusion membrane.

What genetic manipulation techniques have been successful for studying Cdu1 function?

Several genetic approaches have proven effective for investigating Cdu1 function:

  • Transposon mutagenesis: A transposon insertion mutant in the Cdu1-encoding gene (Ctr Tn-cdu1) has been successfully generated and characterized . This mutant produces a truncated Cdu1 protein with impaired secretion to the inclusion surface.

  • Homologous recombination: Targeted integration of modified Cdu1 (e.g., FLAG-tagged) into the C. trachomatis genome has been achieved using suicide plasmids based on Wang et al.'s transformation protocol . This approach allowed expression of tagged Cdu1 under its native promoter.

  • Expression pattern analysis: Recombinant strains expressing Cdu1-FLAG under the control of the original cdu1 promoter have been established, enabling precise tracking of expression kinetics and localization throughout the developmental cycle .

Interestingly, attempts to generate complete Cdu1 knockouts by deleting or interrupting the gene near the N-terminus have been unsuccessful, suggesting potential essentiality of at least some Cdu1 functions for chlamydial viability in cell culture systems.

What biochemical assays can be used to characterize Cdu1's deubiquitinase activity?

To assess Cdu1's deubiquitinase activity, several complementary approaches can be employed:

  • In vitro deubiquitination assays: Using recombinant Cdu1 and ubiquitinated substrates (like Mcl-1) to measure direct deubiquitination activity.

  • Ubiquitin chain specificity assays: Determining Cdu1's preference for specific ubiquitin chain linkages (K48, K63, etc.) using synthetic ubiquitin chains.

  • Cellular ubiquitination status: Analyzing the ubiquitination status of potential substrates in cells infected with wild-type versus Cdu1-deficient Chlamydia through immunoprecipitation followed by anti-ubiquitin Western blotting .

  • Super-resolution microscopy: Structured illumination microscopy (SIM) has been effectively used to visualize co-localization of ubiquitinated Mcl-1 at the inclusion surface, demonstrating reduced ubiquitinated Mcl-1 at inclusions containing wild-type Chlamydia compared to Cdu1-deficient strains .

How can the acetyltransferase activity of Cdu1 be measured?

The acetyltransferase activity of Cdu1 can be assessed through multiple experimental approaches:

  • In vitro acetylation assays: Using purified recombinant Cdu1 with potential substrates and acetyl-CoA as a donor to detect direct acetylation.

  • Mass spectrometry analysis: Identifying acetylated lysine residues on Cdu1 itself and on target proteins.

  • Acetylation-specific antibodies: Western blotting with antibodies recognizing acetylated lysine residues to detect changes in acetylation status of potential substrates.

  • Site-directed mutagenesis: Creating Cdu1 variants with mutations in predicted catalytic residues specifically required for acetyltransferase but not deubiquitinase activity to dissect the relative contributions of each enzymatic function .

  • Stability assays: Monitoring the degradation kinetics of Cdu1 and its potential substrates (InaC, IpaM, CTL0480) in the presence of proteasome inhibitors or ubiquitination pathway modulators .

How does Cdu1 contribute to chlamydial survival within host cells?

Cdu1 employs multiple mechanisms to promote chlamydial survival within host cells:

  • Stabilization of anti-apoptotic factors: Cdu1 deubiquitinates and stabilizes the host anti-apoptotic protein Mcl-1, preventing premature host cell death and allowing completion of the bacterial developmental cycle .

  • Protection of bacterial effectors: Cdu1's acetyltransferase activity protects itself and other chlamydial proteins (InaC, IpaM, and CTL0480) from ubiquitin-mediated degradation after their delivery into host cells .

  • Regulation of bacterial exit: Cdu1 and its protected proteins are required for optimal egress of Chlamydia from host cells, highlighting its role in coordinating late stages of infection .

  • Immune evasion: Cdu1-deficient Chlamydia show increased sensitivity to interferon-γ (IFNγ), suggesting a role in counteracting host immune responses .

Together, these functions establish Cdu1 as a multifaceted virulence factor that orchestrates key aspects of the host-pathogen interface throughout infection.

What is the relationship between Cdu1 and host cell apoptosis regulation?

Cdu1 plays a crucial role in preventing host cell apoptosis through selective stabilization of anti-apoptotic factors:

  • Mcl-1 stabilization: Cdu1 directly interacts with and deubiquitinates Mcl-1, a major anti-apoptotic Bcl-2 family protein with a naturally short half-life . By reducing Mcl-1 ubiquitination, Cdu1 prevents its proteasomal degradation, maintaining high Mcl-1 levels throughout infection.

  • Spatial regulation: Immunofluorescence studies show significant co-localization of Mcl-1 with Cdu1 at the inclusion surface . This spatial concentration of deubiquitination activity creates a zone of enhanced Mcl-1 stability around the inclusion.

  • Multilayered regulation: While Cdu1 contributes to Mcl-1 stabilization, Chlamydia employs multiple mechanisms to maintain high Mcl-1 levels. Early in infection, chlamydial activation of Raf/MEK/ERK and PI3K/AKT signaling pathways increases Mcl-1 expression . In later stages, Cdu1-mediated deubiquitination becomes important for sustaining these elevated levels.

  • Cdu1-independent mechanisms: In cells infected with Cdu1-deficient Chlamydia, Mcl-1 levels are reduced but still higher than in uninfected cells, confirming the existence of redundant mechanisms for apoptosis inhibition .

What is the significance of Cdu1 in chlamydial infection models?

Cdu1 demonstrates significant importance in both in vitro and in vivo infection models:

  • Cell culture models:

    • In human epithelial cell lines, Cdu1-deficient Chlamydia show normal development under standard conditions but exhibit impaired replication when challenged with IFNγ .

    • In primary human fimbriae cells (representing the natural infection site), the Cdu1 mutant shows significantly reduced replication after IFNγ treatment compared to wild-type .

  • Mouse infection model:

    • In a transcervical infection model, mice challenged with Cdu1-deficient Chlamydia (Ctr Tn-cdu1) showed over a log-fold decrease in bacterial burden compared to wild-type or control transposon mutant strains .

    • The table below summarizes bacterial burden data from the mouse infection model:

Bacterial StrainMean Chlamydia/Host Genome RatioStatistical Significance
Wild-type5.4 × 10⁻³Reference
Tn-IGR (control)4.4 × 10⁻³Not significant
Tn-cdu1 (mutant)2.0 × 10⁻⁴p < 0.01

This significant attenuation in the mouse model establishes Cdu1 as an important virulence factor during mammalian infection, particularly under immune pressure.

How does Cdu1 interact with other chlamydial effectors in the inclusion membrane?

The interaction of Cdu1 with other chlamydial effectors represents a complex network at the host-pathogen interface:

  • Inclusion membrane protein interactions: Cdu1 co-localizes with the inclusion membrane protein IncA , suggesting potential physical or functional interactions with the Inc protein family that forms the structural and signaling scaffold of the inclusion membrane.

  • Protection of secreted effectors: Cdu1's acetyltransferase activity protects specific chlamydial proteins (InaC, IpaM, and CTL0480) from degradation after their secretion into the host environment . These protected proteins localize to the pathogen-containing vacuole and are required for optimal bacterial egress, suggesting coordinated function.

  • Effector hierarchy: The requirement of Cdu1's activity for protecting other effectors suggests a hierarchical organization of chlamydial secreted factors, with Cdu1 functioning as a master regulator that ensures the stability of subsequent effectors.

  • Signaling integration: The inclusion membrane serves as a signaling platform that orchestrates chlamydial accommodation inside the host cell . Cdu1's location at this interface positions it to integrate multiple aspects of host-pathogen signaling.

Future research using proximity labeling techniques, protein-protein interaction screens, and functional genomics approaches will be valuable for mapping the complete network of Cdu1 interactions with other chlamydial effectors.

What is the evolutionary significance of Cdu1's structural similarity to mammalian deubiquitinases?

The remarkable structural similarity between chlamydial Cdu1 and mammalian deubiquitinases raises intriguing evolutionary questions:

This structural mimicry exemplifies a sophisticated evolutionary strategy employed by obligate intracellular pathogens to manipulate host cellular processes using familiar biochemical interfaces.

How does Cdu1's dual enzymatic activity (DUB and acetyltransferase) coordinately regulate chlamydial infection?

The integration of Cdu1's dual enzymatic activities represents a sophisticated regulatory mechanism:

  • Hierarchical function: Cdu1's acetyltransferase activity is critical for protecting itself from ubiquitin-mediated degradation , establishing a hierarchical relationship where the acetyltransferase function maintains enzyme stability, which then enables its deubiquitinase activity.

  • Substrate specificity: Each enzymatic activity appears to target different substrates:

    • The deubiquitinase activity primarily targets host proteins like Mcl-1

    • The acetyltransferase activity protects bacterial effectors (InaC, IpaM, CTL0480)

  • Temporal regulation: The relative importance of each activity may change throughout the developmental cycle:

    • Early: Acetyltransferase activity may be crucial for establishing effector stability

    • Mid-late: Deubiquitinase activity becomes important for maintaining host anti-apoptotic factors

  • Mechanistic coordination: Both activities ultimately protect proteins from the ubiquitin-proteasome system but through different mechanisms:

    • Deubiquitinase: Directly removing ubiquitin from already-modified substrates

    • Acetyltransferase: Potentially blocking lysine residues from ubiquitination through competitive modification

This dual functionality in a single enzyme enables Chlamydia to efficiently manipulate multiple aspects of host protein stability with a minimal genomic investment, reflecting the evolutionary pressure on these bacteria to maintain small genomes.

What are the challenges in expressing and purifying recombinant Cdu1 for in vitro studies?

Working with recombinant Cdu1 presents several technical challenges:

  • Membrane association: Cdu1's N-terminal transmembrane domain can cause solubility issues and aggregation during expression and purification. Researchers should consider:

    • Expressing only the catalytic domain (without the transmembrane region)

    • Using detergent-based extraction methods if the full-length protein is required

    • Employing fusion tags that enhance solubility (MBP, SUMO, etc.)

  • Maintaining dual enzymatic activities: Preserving both deubiquitinase and acetyltransferase activities during purification requires careful buffer optimization:

    • Avoiding reducing agents that may disrupt structural zinc-binding sites

    • Including zinc in purification buffers to maintain metalloproteases activity

    • Testing multiple buffer conditions to identify those that preserve both activities

  • Protein stability: Purified Cdu1 may exhibit auto-ubiquitination or auto-acetylation that affects stability and activity. Consider:

    • Adding deubiquitinase inhibitors during purification

    • Employing size exclusion chromatography to separate modified forms

    • Monitoring post-translational modifications by mass spectrometry

  • Activity assays: Developing sensitive and specific assays for both enzymatic activities:

    • Using fluorogenic ubiquitin substrates for deubiquitinase activity

    • Employing radiolabeled or fluorescently labeled acetyl-CoA for acetyltransferase assays

How can researchers differentiate between the effects of Cdu1's deubiquitinase versus acetyltransferase activities in cellular systems?

Dissecting the specific contributions of each enzymatic activity requires strategic experimental approaches:

  • Selective mutagenesis: Generate Cdu1 variants with mutations that selectively inactivate one activity while preserving the other:

    • Mutations in the predicted catalytic cysteine of the DUB domain

    • Alterations to putative acetyltransferase active site residues

    • Structure-guided mutations based on modeling and alignment with known enzymes

  • Domain-specific inhibitors: Employ selective inhibitors that target only one enzymatic function:

    • DUB-specific inhibitors (e.g., PR-619, NSC 632839)

    • Acetyltransferase inhibitors (e.g., garcinol, anacardic acid)

    • Validate inhibitor specificity using in vitro assays with purified enzyme

  • Substrate-specific assays: Monitor distinct substrates known to be targets of each activity:

    • Mcl-1 ubiquitination status for DUB activity

    • Acetylation of bacterial effectors for acetyltransferase activity

  • Complementation analysis: In Cdu1-deficient Chlamydia, express variants with only one functional activity and assess their ability to restore specific phenotypes:

    • IFNγ resistance

    • Bacterial exit efficiency

    • Protection of specific chlamydial proteins

What considerations are important when designing in vivo experiments to study Cdu1's role in chlamydial pathogenesis?

When designing in vivo experiments to investigate Cdu1's role in chlamydial pathogenesis, several key considerations should be addressed:

  • Animal model selection:

    • Mouse models have been successfully used to demonstrate Cdu1's importance in infection

    • Consider tissue tropism differences between human and animal Chlamydia strains

    • Evaluate whether murine cells respond similarly to human cells regarding Mcl-1 regulation

  • Infection methodology:

    • Transcervical infection method has been effective for studying genital tract infections

    • Control for inoculum size and preparation to ensure reproducible results

    • Consider timing of tissue collection based on the chlamydial developmental cycle

  • Readout parameters:

    • Bacterial burden (Chlamydia/host genome ratio) provides quantitative assessment

    • Histopathological evaluation can assess tissue damage and inflammatory response

    • Immunological parameters (cytokine profiles, immune cell infiltration) provide insight into host response

  • Genetic controls:

    • Include appropriate control strains with transposon insertions in non-essential regions (e.g., Tn-IGR)

    • Consider complemented strains to confirm phenotypes are specifically due to Cdu1 disruption

    • Sequence verify mutant strains to ensure no secondary mutations are present

  • Host factors:

    • Consider experiments in immunocompromised mice (e.g., IFNγ-knockout) to assess whether Cdu1's role is specifically linked to immune evasion

    • Evaluate sex-based differences in infection susceptibility and response

    • Control for estrous cycle in female mice, which can affect susceptibility to chlamydial infection

What are promising approaches for developing inhibitors targeting Cdu1 as potential therapeutic agents?

Developing Cdu1-specific inhibitors presents an attractive therapeutic strategy for chlamydial infections:

  • Structure-based drug design: Utilize the known structural similarities and differences between Cdu1 and mammalian deubiquitinases:

    • Target the unique α-helix near Cdu1's substrate-binding pocket

    • Exploit structural features specific to the chlamydial enzyme to achieve selectivity

    • Employ in silico docking studies to identify potential binding molecules

  • Dual-activity inhibitors: Design compounds that simultaneously inhibit both deubiquitinase and acetyltransferase functions:

    • Identify overlapping structural elements required for both activities

    • Develop allosteric inhibitors that affect enzyme conformation

  • Delivery strategies: Address challenges in delivering inhibitors to intracellular bacteria:

    • Design membrane-permeable inhibitor conjugates

    • Explore nanoparticle-based delivery systems that can penetrate the inclusion membrane

    • Consider pro-drug approaches activated by bacterial or host enzymes

  • Phenotypic screening: Develop cellular assays that monitor Cdu1-dependent phenotypes:

    • Mcl-1 stabilization in infected cells

    • Protection of chlamydial effectors from degradation

    • Bacterial egress efficiency

  • Combination approaches: Evaluate synergistic effects with existing antibiotics:

    • Cdu1 inhibitors could sensitize Chlamydia to immune responses and standard antimicrobials

    • Target multiple chlamydial effectors simultaneously to overcome potential redundancy

How might Cdu1 interaction with the host ubiquitin system differ across various cell types and tissues?

The interaction between Cdu1 and host ubiquitin systems likely exhibits cell-type specific variations:

  • Cell-type specific ubiquitin landscapes: Different host cells may express varying levels of:

    • E3 ubiquitin ligases targeting Mcl-1 (e.g., MULE, FBW7, β-TrCP)

    • Deubiquitinases competing with Cdu1 (e.g., USP9X)

    • Ubiquitin-binding proteins that affect substrate recognition

  • Tissue-specific regulation: Experimental evidence already suggests differential importance of Cdu1 across systems:

    • Critical for infection in primary human fimbriae cells when challenged with IFNγ

    • Significant impact on bacterial burden in mouse genital tract infections

    • Potentially different roles in other tissue sites infected by Chlamydia

  • Immune context variations: The importance of Cdu1 appears enhanced under immune pressure:

    • IFNγ treatment reveals dependency on Cdu1 for bacterial replication

    • Different tissues have varying baseline levels of immune activation

    • Immune cell types may have unique ubiquitin system regulation

  • Methodological approaches:

    • Compare Cdu1-dependent phenotypes across multiple cell types (epithelial cells, fibroblasts, immune cells)

    • Analyze tissue-specific proteomes for variations in ubiquitin pathway components

    • Develop organoid or tissue-specific models to better recapitulate in vivo conditions

Understanding these cell-type specific variations could help explain the tissue tropism of different Chlamydia species and guide the development of targeted therapeutic approaches.

What is the potential role of Cdu1 homologs in other Chlamydia species and intracellular pathogens?

Comparative analysis of Cdu1 homologs across bacterial species provides insights into evolutionary adaptation:

  • Conservation across Chlamydia species: Cdu1-like proteins are present in multiple chlamydial species:

    • Structural elements are conserved in C. suis, C. muridarum, C. psittaci, and C. gallinaceai

    • C. trachomatis also encodes a paralog, Cdu2, with similar structural features

    • Functional conservation across species should be experimentally verified

  • Evolutionary significance: The presence of eukaryotic-like deubiquitinases in intracellular bacteria suggests:

    • Strong selection pressure to manipulate host ubiquitin systems

    • Potential ancient horizontal gene transfer events

    • Convergent evolution toward similar mechanisms for host manipulation

  • Comparative functional analysis: Systematic comparison of homologs could reveal:

    • Species-specific substrate preferences

    • Variations in enzymatic activities (some may have only DUB or only acetyltransferase activity)

    • Differences in localization and integration with other bacterial effectors

  • Methodological approaches:

    • Heterologous expression of homologs in C. trachomatis Cdu1-deficient strains to assess functional complementation

    • Structural and biochemical characterization of purified homologs

    • Comparative genomics and evolutionary analyses to trace the acquisition and adaptation of these genes

Understanding the broader functional landscape of Cdu1-like proteins across bacterial species could reveal fundamental principles of host-pathogen interaction and identify conserved targets for broad-spectrum therapeutic development.

What are the key takeaways about Cdu1's role in chlamydial pathogenesis?

Cdu1 represents a sophisticated virulence factor that exemplifies how intracellular pathogens manipulate host cellular processes:

  • Multifunctional enzyme: Cdu1 combines deubiquitinase and acetyltransferase activities in a single protein, enabling efficient manipulation of protein stability with minimal genomic investment .

  • Strategic localization: By anchoring to the inclusion membrane with its catalytic domain facing the host cytosol, Cdu1 creates a microenvironment where it can selectively stabilize both host and bacterial proteins .

  • Host cell survival: Through deubiquitination of Mcl-1, Cdu1 contributes to preventing premature host cell death, allowing completion of the bacterial developmental cycle .

  • Effector protection: Cdu1's acetyltransferase activity protects itself and other bacterial effectors from degradation after secretion into the hostile host environment .

  • Critical for in vivo infection: Genetic disruption of Cdu1 significantly attenuates infection in mouse models, establishing it as an important virulence factor under physiological conditions .

  • Immune evasion: Cdu1 appears particularly important under immune pressure, as evidenced by the increased sensitivity of Cdu1-deficient bacteria to IFNγ .

Together, these findings establish Cdu1 as a multifaceted virulence factor that orchestrates critical aspects of host-pathogen interaction throughout chlamydial infection.

How can insights from Cdu1 research inform our broader understanding of host-pathogen interactions?

Research on Cdu1 provides valuable insights that extend beyond chlamydial biology:

  • Convergent virulence strategies: The evolution of eukaryotic-like enzymes in bacteria highlights how diverse pathogens converge on manipulating similar host pathways despite different evolutionary histories.

  • Protein stability as a virulence target: Cdu1's focus on manipulating protein stability through both deubiquitination and acetylation emphasizes the central importance of post-translational modifications in host-pathogen interactions.

  • Interface biology: The concentration of enzymatic activity at the pathogen-host interface (the inclusion membrane) exemplifies how spatial organization of biochemical activities can create microenvironments that favor pathogen survival.

  • Multifunctional proteins: Cdu1's dual enzymatic activities within a single protein illustrate how intracellular pathogens with limited genomic capacity evolve multifunctional proteins to maximize their manipulation of host systems.

  • Therapeutic targets: The attenuation of infection upon Cdu1 disruption suggests that targeting pathogen-encoded enzymes that manipulate host post-translational modifications could be a productive strategy for developing novel anti-infectives.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.