Recombinant Chlamydia trachomatis serovar L2 Deubiquitinase and deneddylase Dub2 (cdu2)

Shipped with Ice Packs
In Stock

Description

Protein Domains and Functional Regions

ChlaDUB2 contains several distinct functional domains that contribute to its activity. The most critical is the catalytic core, which houses the active site responsible for deubiquitinating activity. Crystal structure analysis of the DUB domain (PDB: 6MRN) has revealed specific binding interfaces that mediate interactions with ubiquitin molecules . These structural details provide insights into how ChlaDUB2 recognizes and processes its substrates.

Table 1: Key Properties of Recombinant ChlaDUB2 Protein

PropertyDetail
Protein NameDeubiquitinase and deneddylase Dub2 (ChlaDub2)
OrganismChlamydia trachomatis serovar L2
UniProt AccessionB0B999
Gene Namecdu2 (CTL0246)
Length339 amino acids
Molecular FunctionDeubiquitinase (EC 3.4.22.-)
Crystal StructurePDB ID: 6MRN
Catalytic ResidueHis203 (critical for activity)

Enzymatic Mechanisms and Functional Properties

ChlaDUB2 functions primarily as a deubiquitinase, catalyzing the removal of ubiquitin molecules from host cell proteins . This enzymatic activity allows Chlamydia to manipulate host cell ubiquitination pathways, which are critical for numerous cellular processes including protein degradation, trafficking, and immune signaling.

Comparative Enzymatic Activity

A particularly noteworthy aspect of ChlaDUB2 is its distinct substrate preference compared to its paralog ChlaDUB1. Despite structural similarities between these two deubiquitinases, they exhibit marked differences in enzymatic activity . Research has demonstrated that while both enzymes can efficiently cleave monoubiquitin-based substrates such as ubiquitin aminomethylcoumarin (Ub-AMC), their activities diverge significantly when processing more complex ubiquitin chains .

ChlaDUB2 shows limited efficiency in cleaving diubiquitin substrates, whereas ChlaDUB1 can rapidly hydrolyze these substrates in a manner similar to prototypical prokaryotic DUBs like SdeA . This suggests that ChlaDUB2 may have evolved for more specialized functions during infection, targeting specific ubiquitinated substrates rather than performing broad deubiquitination .

Table 2: Comparative Enzymatic Properties of ChlaDUB1 and ChlaDUB2

PropertyChlaDUB1ChlaDUB2
Monoubiquitin (Ub-AMC) cleavageEfficientEfficient
Diubiquitin cleavageEfficientLimited
Polyubiquitin chain cleavageBroad activitySubstrate-specific
Secondary activityAcetyltransferase (AcT)None (dedicated DUB)
Distal ubiquitin bindingPresentPresent
Additional activitiesLys63-deubiquitinase, Lys-acetyltransferaseDeubiquitinase only

Molecular Basis for Functional Differences

The distinct recognition patterns for differently linked polyubiquitin chains highlight the specialized nature of these bacterial effectors. ChlaDUB1 and ChlaDUB2 appear to have evolved complementary activities that together provide Chlamydia with versatile tools to modulate host ubiquitin signaling during infection .

Role in Chlamydia Pathogenesis

Chlamydia trachomatis actively secretes ChlaDUB2 during infection, along with its paralog ChlaDUB1 . These effector proteins are translocated across the inclusion membrane (the pathogen-containing vacuole) to the cytoplasmic face, where they can interact with host cell proteins and organelles .

Impact on Host Cell Processes

One of the most significant findings regarding ChlaDUB2's role in pathogenesis relates to its impact on the host Golgi apparatus. During Chlamydia infection, the Golgi apparatus undergoes fragmentation and redistribution around the inclusion, a critical process for bacterial development . Research using a mutant strain harboring a catalytically inactive ChlaDUB2 variant (H203Y) demonstrated that the deubiquitinase activity of ChlaDUB2 is essential for this Golgi fragmentation process .

Interestingly, both ChlaDUB1 and ChlaDUB2 appear to contribute non-redundantly to Golgi fragmentation, suggesting either distinct targets or a strict dose-dependency on the combined DUB activity introduced by these effectors . The comparable impact of mutating either enzyme indicates their collaborative role in this process.

Growth and Virulence Implications

Despite its importance for Golgi fragmentation, the Cdu2-H203Y mutant strain showed minimal impact on bacterial growth in both HeLa and A549 cell lines, contrasting with the cdu1-Tn mutant strain that exhibited significant growth defects in A549 cells . This suggests that ChlaDUB2's primary role may relate more to specific aspects of host cell manipulation rather than directly impacting bacterial replication efficiency.

Table 3: Effects of ChlaDUB1 and ChlaDUB2 Mutations on Chlamydia infection

ParameterChlaDUB1 Mutant (cdu1-Tn)ChlaDUB2 Mutant (Cdu2-H203Y)
Growth in HeLa cellsNo significant reductionNo significant reduction
Growth in A549 cells90% reduction in progenyNo significant reduction
Golgi fragmentationImpairedImpaired
In vivo mouse modelReduced infectionNot reported

Future Research Directions

The unique properties of ChlaDUB2 and its specific role in Chlamydia pathogenesis highlight several promising avenues for future research. Understanding the exact molecular targets of ChlaDUB2 in host cells could reveal critical host-pathogen interactions that might be exploited for therapeutic intervention . Additionally, the distinct substrate preferences of ChlaDUB2 compared to ChlaDUB1 warrant further investigation to fully elucidate their complementary roles during infection .

The potential for ChlaDUB2-targeted therapeutics represents an exciting direction for addressing Chlamydia infections. As a dedicated deubiquitinase with specific functions in host cell manipulation, ChlaDUB2 could serve as an attractive target for developing novel antimicrobial strategies that specifically disrupt Chlamydia's ability to manipulate host processes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
cdu2; CTL0246; Deubiquitinase and deneddylase Dub2; ChlaDub2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)
Target Names
cdu2
Target Protein Sequence
MEPIHNPPPQTCSYSRPSTTYTSFKDASCDTKVTRIIIALFLIVISCGLILCAYTFRDLL DADYLAQEGPQQATKLLQQLDDVLTGPPLPIWDNEHLFQFSCLMQNKHRRVLPIDICNPL TKFNFLECICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEYRCVTFFDSLCDYVASPQQMREQLEGLA VSLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPTNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Uniprot No.

Target Background

Function
Effector proteins play a crucial role in modifying host cell physiology, contributing to bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities.
Database Links

KEGG: ctb:CTL0246

Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.