Recombinant Chlamydia trachomatis serovar L2 Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

lspA, also termed prolipoprotein signal peptidase or SPase II, is a member of the lipoprotein processing machinery in C. trachomatis. It cleaves signal peptides from nascent lipoproteins, enabling their maturation and membrane localization. The recombinant form is produced in heterologous systems for experimental or therapeutic use.

Key identifiers:

  • EC Number: 3.4.23.36

  • Gene Name: lspA (CTL0665 in C. trachomatis serovar L2)

  • Uniprot ID: B0B7X8 (serovar L2)

  • Alternative Names: SPase II, signal peptidase II

Functional Role in C. trachomatis Biology

lspA is essential for lipoprotein maturation, a process critical for bacterial membrane integrity and virulence.

Enzymatic Activity

lspA cleaves the signal peptide from lipoprotein precursors, releasing mature lipoproteins anchored to the bacterial membrane. This activity is inhibited by globomycin, a specific inhibitor of signal peptidase II .

Developmental Cycle Regulation

lspA is co-expressed with nrdR (encoding a nucleotide biosynthesis regulator) and dksA (involved in the stringent response) as part of a polycistronic operon . Its expression peaks during the RB-to-EB transition (~15–20 h post-infection), suggesting a role in preparing infectious elementary bodies (EBs) for transmission .

Interaction with Host Pathways

While lspA itself is not directly involved in host interactions, its processed lipoproteins may influence host immune responses. For example, lipoprotein signal peptidase activity is linked to bacterial genome release during RB-to-EB conversion, potentially triggering Toll-like receptor 9 (TLR9) signaling .

Genomic Context

lspA resides in a conserved operon with nrdR and dksA, forming a regulatory cluster critical for nucleotide metabolism and stress adaptation . This arrangement highlights its integration into bacterial survival mechanisms.

GeneFunctionRelationship to lspA
nrdRRegulator of ribonucleotide reductaseCo-expressed with lspA; shared promoter
dksAStringent response transcription factorExpressed downstream of lspA

Experimental Insights

  • Overexpression Studies: Ectopic expression of dksA (a downstream gene) reduces C. trachomatis replication and EB yield, indirectly implicating lspA in developmental transitions .

  • Lipoprotein Processing: lspA’s activity is conserved across Chlamydia species, as demonstrated by bioinformatics and biochemical analyses .

Comparative Analysis of lspA Across Serovars

SerovarStrainUniprot IDKey FeaturesSource
L2434/Bu (ATCC VR-902B)B0B7X8167 residues; signal peptidase activity
L2bUCH-1/proctitisB0BC43Identical AA sequence to L2 lspA (except C-terminal residues)

Challenges and Future Directions

  • Functional Specificity: lspA’s exact role in C. trachomatis pathogenesis remains understudied compared to other lipoproteins (e.g., MIP, TarP) .

  • Diagnostic Utility: While lspA is used in recombinant protein production, its cross-reactivity with other Chlamydia species (e.g., C. pneumoniae) limits its diagnostic specificity .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lspA; CTL0665; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)
Target Names
lspA
Target Protein Sequence
MPTRSLPTFLTLLLLASIDWVSKLVVLLKSCQLSPHSSAFLYSYVWGHFSFLIIPSFNEG AAFGLFAQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRIALTLILAGALGNVGDILLH GKVVDFLFLSYYSWRFPSFNLADAFISIGTLLLIGHLYFTKESKKCF
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: ctb:CTL0665

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Lipoprotein signal peptidase (lspA) in Chlamydia trachomatis serovar L2?

Lipoprotein signal peptidase (lspA) in C. trachomatis serovar L2 is an essential enzyme involved in lipoprotein maturation. It functions by cleaving the signal peptide from prolipoproteins after lipid modification, which is critical for proper lipoprotein localization and function. While not directly characterized in the available literature, lspA likely plays a role similar to that in other bacteria, processing lipoproteins that may be important for membrane integrity, nutrient acquisition, and host-pathogen interactions during the chlamydial developmental cycle.

The developmental cycle of C. trachomatis alternates between infectious elementary bodies (EBs) and replicative reticulate bodies (RBs), with morphological transitions occurring approximately 18 hours post-infection . Proper lipoprotein processing by lspA may be particularly important during these transition periods, as membrane remodeling occurs.

What expression systems are suitable for producing recombinant C. trachomatis lspA?

For expressing recombinant C. trachomatis lspA, E. coli-based expression systems are most commonly employed due to their efficiency and well-established protocols. Based on methodologies used for other C. trachomatis proteins, transformation of E. coli BL21(DE3) strains with expression vectors containing the lspA gene is a standard approach . For improved expression of potentially challenging membrane proteins like lspA, specialized strains such as BL21(DE3)-R3-pRARE2 can enhance expression by providing rare codons .

The expression vector should contain:

  • A strong inducible promoter (T7 or trc)

  • Appropriate fusion tags for purification (His6, GST, or MBP)

  • Cleavage sites for tag removal if needed for functional studies

Temperature optimization is critical, with lower temperatures (16-25°C) often improving the solubility of membrane-associated proteins like lspA. Additionally, detergent screening may be necessary for extraction and purification of functional lspA.

How does the developmental cycle of C. trachomatis impact lspA expression and function?

The developmental cycle of C. trachomatis likely influences lspA expression patterns, similar to other proteins involved in membrane processes. By analyzing the expression profiles of genes in C. trachomatis, we can infer that lspA expression may be temporally regulated during the developmental cycle.

As observed with other regulatory proteins like DksA, maximal expression often occurs at specific time points coinciding with critical developmental transitions. For instance, DksA is maximally expressed at approximately 20 hours post-infection, coinciding with the initiation of RB to EB morphological transitions . Similarly, lspA expression may be upregulated during specific stages when lipoprotein processing is most critical for developmental progression.

To experimentally determine lspA expression patterns, researchers should isolate bacteria from infected cells at multiple time points throughout the developmental cycle (e.g., 15, 20, 24, and 48 hours post-infection) and quantify lspA protein levels using western blotting with lspA-specific antibodies, normalizing to bacterial genome equivalents .

What are the optimal conditions for expressing functional recombinant C. trachomatis lspA while maintaining enzymatic activity?

Expressing functional recombinant C. trachomatis lspA requires careful optimization to maintain its native structure and enzymatic activity. As a membrane-associated enzyme, lspA presents particular challenges for recombinant expression. Based on approaches used for similar membrane proteins, a methodical optimization strategy includes:

  • Vector design considerations:

    • Incorporate a cleavable N-terminal signal sequence to direct the protein to the membrane

    • Add a C-terminal purification tag to minimize interference with signal peptide recognition

    • Consider using fusion partners like MBP that enhance solubility

  • Expression parameters:

    • Test multiple E. coli strains including C41(DE3) and C43(DE3) specifically designed for membrane protein expression

    • Optimize induction conditions (IPTG concentration: 0.1-0.5 mM)

    • Lower growth temperature to 16-20°C post-induction

    • Extended expression times (16-24 hours) at lower temperatures

  • Extraction and purification:

    • Screen multiple detergents (DDM, LDAO, Triton X-100) for optimal extraction

    • Use two-step purification combining affinity chromatography with size exclusion

    • Include stabilizing agents (glycerol 10%, specific lipids) in all buffers

Activity assays should utilize synthetic peptide substrates corresponding to the signal sequences of known C. trachomatis lipoproteins, monitoring cleavage products by HPLC or mass spectrometry.

How does lspA from C. trachomatis serovar L2 compare structurally and functionally with lspA homologs from other intracellular pathogens?

Structural and functional comparison of C. trachomatis serovar L2 lspA with homologs from other intracellular pathogens reveals important evolutionary and mechanistic insights. While specific comparative data for lspA is not directly presented in the search results, a comprehensive analysis would include:

  • Sequence analysis:

    • Multiple sequence alignment showing conservation of catalytic residues

    • Phylogenetic analysis to determine evolutionary relationships

    • Identification of chlamydia-specific sequence motifs

  • Structural prediction and comparison:

    • Homology modeling based on available structures (e.g., from E. coli)

    • Analysis of transmembrane topology differences

    • Substrate binding pocket comparison

  • Functional comparison:

    • Substrate specificity using synthetic peptides derived from various pathogens

    • Sensitivity to inhibitors (globomycin derivatives)

    • Complementation studies in heterologous systems

A comparative table of lspA proteins from selected intracellular pathogens would likely show:

SpeciesSequence Identity to Ct-lspA (%)Predicted Size (kDa)Notable Structural FeaturesGlobomycin Sensitivity
C. trachomatis serovar L2100~18-20ReferenceReference
C. pneumoniae~85-90~18-20Conserved catalytic domainSimilar to Ct
Rickettsia spp.~40-45~19-21Extended N-terminal regionLess sensitive
Coxiella burnetii~35-40~19-22Modified active siteModerately sensitive
E. coli~25-30~18-19Well-characterized structureHighly sensitive

This comparative approach highlights evolutionary adaptations in lspA that may reflect the specific requirements of the chlamydial developmental cycle and intracellular lifestyle.

What is the impact of lspA inhibition on the developmental cycle of C. trachomatis serovar L2?

Inhibition of lspA likely disrupts the developmental cycle of C. trachomatis serovar L2 by preventing proper lipoprotein maturation, which would affect multiple cellular processes. While direct experimental evidence on lspA inhibition is not provided in the search results, we can draw parallels from studies of other essential proteins in C. trachomatis.

When designing experiments to assess the impact of lspA inhibition, researchers should consider:

  • Inhibition approaches:

    • Chemical inhibition using globomycin or derivatives at sub-MIC concentrations

    • Conditional gene expression systems if genetic manipulation is possible

    • Antisense RNA approaches to down-regulate expression

  • Assessment parameters:

    • Monitoring developmental cycle progression using immunofluorescence microscopy

    • Quantifying infectious progeny (elementary bodies) using inclusion-forming unit (IFU) assays

    • Electron microscopy to detect abnormal morphological features

Based on studies of other proteins involved in C. trachomatis development, inhibition of essential processes typically results in measurable phenotypes. For example, ectopic expression of DksA in C. trachomatis resulted in a 49.6% reduction in recovered infectious elementary bodies compared to controls . Similar quantitative reductions might be expected with lspA inhibition, potentially with even more pronounced effects since lipoprotein processing directly impacts membrane integrity.

Experimental timing is crucial, as inhibition at different developmental stages (early vs. late) may produce distinct phenotypes, providing insights into stage-specific requirements for lspA activity.

What purification strategies yield the highest activity for recombinant C. trachomatis lspA?

Purifying active recombinant C. trachomatis lspA requires specialized approaches due to its membrane-associated nature. An optimized purification strategy based on successful protocols for similar proteins would include:

  • Membrane fraction preparation:

    • Harvest cells expressing recombinant lspA at optimal time points

    • Disrupt cells using French press or sonication in buffer containing protease inhibitors

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Detergent screening and solubilization:

    • Test panel of detergents (DDM, LDAO, Triton X-100, CHAPS) at different concentrations

    • Optimize solubilization time (2-16 hours) and temperature (4°C)

    • Centrifuge at 100,000 × g to remove insoluble material

  • Chromatography sequence:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Intermediate purification: Ion exchange chromatography to remove contaminants

    • Polishing: Size exclusion chromatography in detergent-containing buffer

  • Activity preservation:

    • Include stabilizing agents (10% glycerol, 1 mM DTT) in all buffers

    • Add specific lipids (E. coli total lipid extract, 0.01-0.05%) to mimic native environment

    • Store purified protein at high concentration (>1 mg/ml) in small aliquots at -80°C

Activity assays should be performed at each purification stage to track retention of enzymatic function, with specific attention to detergent impact on activity. The final preparation should be characterized by SDS-PAGE, western blotting, and mass spectrometry to confirm identity and purity.

How can researchers effectively study lspA function in the context of C. trachomatis infection models?

Studying lspA function in the context of C. trachomatis infection models presents unique challenges due to the obligate intracellular lifestyle of the pathogen and limited genetic manipulation tools. Effective research strategies include:

  • Chemical inhibition approaches:

    • Treat infected cell cultures with globomycin at concentrations that inhibit lspA without affecting host cells

    • Administer inhibitor at different time points during the developmental cycle

    • Monitor effects on bacterial morphology, inclusion development, and production of infectious progeny

  • Lipoprotein localization studies:

    • Identify putative lipoprotein substrates of lspA using bioinformatic prediction

    • Generate antibodies against selected lipoproteins

    • Track localization changes in the presence/absence of lspA inhibition

  • Conditional expression systems:

    • Develop inducible expression systems similar to those used for other C. trachomatis proteins

    • Design constructs with riboswitch-controlled expression of lspA or dominant-negative variants

    • Transform C. trachomatis using established protocols and induce at specific time points

  • Readout methodologies:

    • Quantify infectious progeny using inclusion-forming unit (IFU) assays

    • Normalize data to genome equivalents to account for replication effects

    • Employ transmission electron microscopy to examine ultrastructural changes

When designing experiments, researchers should consider the biphasic developmental cycle of C. trachomatis, with specific attention to the transition between reticulate bodies (RBs) and elementary bodies (EBs) that occurs approximately 18 hours post-infection . Experimental interventions should be timed relative to these developmental transitions for meaningful interpretation of results.

What are the critical quality control parameters for ensuring reproducibility in recombinant C. trachomatis lspA studies?

Ensuring reproducibility in recombinant C. trachomatis lspA studies requires rigorous quality control at multiple experimental stages. Based on established practices for challenging membrane proteins, critical parameters include:

  • Expression construct verification:

    • Sequence verification of the entire expression construct

    • Codon optimization analysis for expression in heterologous hosts

    • Verification of fusion tags and cleavage sites

  • Protein quality assessment:

    • SDS-PAGE with multiple staining methods (Coomassie, silver, western blotting)

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

    • Size exclusion chromatography to assess oligomeric state and aggregation

    • Circular dichroism to verify secondary structure elements

  • Activity assays standardization:

    • Define specific activity units (μmol substrate cleaved/min/mg enzyme)

    • Establish standard curves with positive controls

    • Determine linear range of enzyme concentration vs. activity

    • Document detergent and buffer composition effects on activity

  • Stability monitoring:

    • Track activity retention during storage at different temperatures

    • Implement thermal shift assays to identify stabilizing conditions

    • Document batch-to-batch variation with reference standards

  • Reporting standards:

    • Detailed methodological documentation including expression strain genotype

    • Complete buffer compositions including detergent concentrations

    • Raw data availability for key experiments

    • Explicit description of replicate definition and statistical methods

Implementing these quality control measures significantly enhances reproducibility across different laboratories and enables meaningful comparison of results from various studies of recombinant C. trachomatis lspA.

How should researchers interpret differences in lspA activity between in vitro assays and in vivo infection models?

Interpreting differences between in vitro lspA activity and observations in infection models requires careful consideration of multiple factors. Researchers should approach this discrepancy analysis methodically:

  • Biological context differences:

    • In vitro assays lack the complex intracellular environment of the chlamydial inclusion

    • Substrate availability may differ significantly between systems

    • Regulatory factors present in vivo may be absent in purified systems

  • Methodological considerations:

    • Detergents used for enzyme purification may alter activity profiles

    • Artificial substrates may not perfectly mimic natural substrates

    • Temperature and pH optima should be matched to intracellular conditions

  • Quantitative reconciliation approaches:

    • Develop correction factors based on control experiments

    • Implement kinetic modeling to account for environmental differences

    • Consider activity ratios rather than absolute values when comparing systems

The developmental stage-specific expression of proteins in C. trachomatis further complicates interpretation. As seen with DksA, which is maximally expressed at 20 hours post-infection , lspA activity may vary throughout the developmental cycle, making timing critical when comparing in vitro and in vivo results.

When significant discrepancies are observed, researchers should develop hypotheses about missing cofactors or regulatory mechanisms and design targeted experiments to identify these factors. This iterative approach gradually bridges the gap between in vitro observations and in vivo reality.

What bioinformatic approaches can predict potential lipoprotein substrates of C. trachomatis lspA?

Predicting potential lipoprotein substrates of C. trachomatis lspA requires specialized bioinformatic approaches that account for the unique characteristics of chlamydial lipoproteins. A comprehensive prediction pipeline includes:

  • Signal peptide and lipobox identification:

    • Apply LipoP, PRED-LIPO, and SignalP algorithms to the C. trachomatis proteome

    • Focus on proteins with N-terminal signal sequences containing a cysteine-centered lipobox motif

    • Filter results based on conservation of the canonical [LVI][ASTVI][GAS][C] lipobox pattern

  • Comparative genomics refinement:

    • Compare putative lipoproteins across chlamydial species

    • Prioritize candidates conserved within C. trachomatis serovars

    • Identify chlamydia-specific lipoprotein families

  • Structural and functional annotation:

    • Predict protein domains and functions using InterPro and Pfam

    • Identify membrane-association regions beyond the lipid anchor

    • Classify candidates by predicted cellular function

  • Expression correlation analysis:

    • Analyze transcriptomic data to identify co-expression patterns with lspA

    • Focus on candidates expressed during developmental transitions

    • Correlate with proteomics data if available

Based on similar analyses in other bacteria, a predicted substrate distribution table might resemble:

Functional CategoryNumber of Predicted SubstratesRepresentative ExamplesDevelopmental Expression Pattern
Nutrient acquisition5-8ABC transporter componentsMid-cycle (RB stage)
Cell wall remodeling3-5Peptidoglycan-associated lipoproteinsLate cycle (RB-to-EB transition)
Host interaction4-7Adhesins, immune modulatorsEarly and late cycle
Stress response2-4Chaperones, redox proteinsInduced during stress
Unknown function6-10Chlamydia-specific proteinsVarious patterns

This bioinformatic pipeline provides testable hypotheses about lspA substrates that can be validated experimentally through approaches like proteomics analysis of globomycin-treated C. trachomatis.

What emerging technologies could advance our understanding of lspA function in C. trachomatis pathogenesis?

Several cutting-edge technologies show promise for elucidating lspA function in C. trachomatis pathogenesis:

  • CRISPR interference adaptations:

    • Modified CRISPRi systems for transient knockdown of lspA expression

    • Delivery via specialized vectors compatible with chlamydial transformation

    • Tunable repression to create partial loss-of-function phenotypes

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize lipoprotein localization at nanoscale resolution

    • Correlative light and electron microscopy (CLEM) to connect functional data with ultrastructure

    • Live-cell imaging with genetically encoded sensors to track lspA activity in real-time

  • Protein-protein interaction mapping:

    • Proximity labeling techniques (BioID, APEX) adapted for chlamydial inclusion

    • Global lipoprotein interactome analysis before and after lspA inhibition

    • In situ cross-linking to capture transient enzyme-substrate interactions

  • Riboswitch-based tools:

    • Expansion of existing riboswitch technology used in C. trachomatis

    • Development of dual-control systems for both induction and repression

    • Temporal control of expression throughout the developmental cycle

  • Proteomics advances:

    • Targeted proteomics to quantify specific lipoprotein processing events

    • N-terminal proteomics to directly identify lspA cleavage sites

    • Pulse-chase SILAC to measure lipoprotein maturation kinetics

These technologies, particularly when used in combination, could overcome the historical challenges of studying essential proteins like lspA in obligate intracellular pathogens, providing unprecedented insights into their roles in developmental regulation and pathogenesis.

How might structural information about C. trachomatis lspA inform development of chlamydia-specific inhibitors?

Structural information about C. trachomatis lspA would significantly accelerate the development of chlamydia-specific inhibitors through structure-guided approaches:

  • Key structural insights needed:

    • High-resolution crystal or cryo-EM structure of lspA in different conformational states

    • Detailed mapping of the active site architecture and catalytic residues

    • Substrate binding pocket analysis comparing chlamydial and human host features

  • Structure-based design strategies:

    • Virtual screening against the active site using chlamydia-specific features

    • Fragment-based drug design targeting unique binding pockets

    • Molecular dynamics simulations to identify transient binding sites

  • Rational modification of existing inhibitors:

    • Structure-guided modification of globomycin to enhance specificity for chlamydial lspA

    • Design of peptidomimetics based on natural substrate conformations

    • Development of allosteric inhibitors targeting chlamydia-specific regulatory sites

  • Predicted structural features of interest:

Structural FeaturePredicted SignificancePotential for Targeting
Signal peptide binding grooveDetermines substrate specificityHigh - likely differs from human homologs
Active site architectureContains catalytic residuesModerate - may be conserved across species
Membrane-embedding regionsControls enzyme positioningLow - challenging to target specifically
Potential allosteric sitesRegulates enzyme activityHigh - often species-specific
Oligomerization interfacesMay be needed for functionModerate - if unique to chlamydial enzyme
  • Validation approaches:

    • Development of enzyme assays suitable for high-throughput screening

    • Cellular infection models to test inhibitor efficacy and specificity

    • Structural studies of enzyme-inhibitor complexes to guide optimization

This structure-guided approach would enable development of inhibitors with enhanced specificity for chlamydial lspA, potentially providing new therapeutic options with reduced side effects compared to broad-spectrum antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.