Recombinant Chlamydia trachomatis serovar L2b Deubiquitinase and deneddylase Dub1 (cdu1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cdu1; CTLon_0243; Deubiquitinase and deneddylase Dub1; ChlaDub1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Target Names
cdu1
Target Protein Sequence
MLSPTNSTSKTAPVPPRDSSKPVLISEEPRNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTHPSTKEQPTISIPVPLPSPPLAVPRPSTPPAPTPAISRPSTPSAPKPS TPPPLLPKAPKPVKTQENLFPLVPEQVFVEMYEDMARRRIIEALVPAWDSDIIFKCLCYF HTLYPGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICCSKENYRRHLQG TTLLPMFMWYHPTPKTLADTMQTMKQLAIKGSVGASHWLLVIVDIQARRLVYFDSLYNYV MPPEDMKKDLQSLAQQLDQVYPARNGQKFSVKIAAKEVIQKDSGFSCGAWCCQFLYWYLR DPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELSWPEA
Uniprot No.

Target Background

Function

Recombinant Chlamydia trachomatis serovar L2b Deubiquitinase and Deneddylase Dub1 (cdu1): Effector proteins modulate host cell physiology, enhancing bacterial survival within host tissues. This protease exhibits both deubiquitinating and deneddylating activities.

Database Links
Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Q&A

What is Cdu1 and what are its main functional domains?

Cdu1 (also known as ChlaDUB1) is a 403-amino acid protein secreted by Chlamydia trachomatis that possesses dual enzymatic activities: deubiquitinase (DUB) and lysine acetyltransferase functions . The full-length protein contains several key structural elements that contribute to its functionality, including an N-terminally extended α-helix that is critical for its enhanced activity compared to its paralog Cdu2 . This protein plays important roles in the maintenance of chlamydial infection, particularly through modulation of host ubiquitination processes .

Structurally, Cdu1 contains a catalytic domain responsible for deubiquitinase activity and regions that mediate its acetyltransferase function. Experimental analysis has demonstrated that the protein's structure includes specific ubiquitin binding interfaces that determine its linkage specificity toward different ubiquitin chain types .

How does Cdu1 differ functionally from Cdu2?

Despite sharing structural similarities in their catalytic domains, Cdu1 and Cdu2 exhibit markedly different substrate specificities and enzymatic activities:

FeatureCdu1Cdu2Reference
Diubiquitin hydrolysisEfficiently cleavesPoor activity
Polyubiquitin chain disassemblyEfficiently disassembles to monoubiquitinDepletes substrate but produces minimal monoubiquitin
K48/K63 poly-UB chain activityHighly activeLimited activity
Monoubiquitin substrate (Ub-AMC)ActiveSimilar activity to Cdu1
Structural distinctionsContains N-terminally extended α-helixLacks the N-terminal α-helix extension

The molecular basis for these functional differences appears to be related to differential recognition of longer ubiquitinated substrates, possibly involving additional ubiquitin binding sites in Cdu1 that are absent in Cdu2 . The striking elevation in Cdu1's activity compared to Cdu2 has been specifically attributed to its N-terminally extended α-helix structure .

What experimental systems are optimal for studying Cdu1 function in vitro?

For in vitro analysis of Cdu1 function, recombinant protein expression systems have proven valuable. The following methodological approach has been successfully employed:

  • Expression system selection: E. coli has been successfully used to express recombinant full-length Cdu1 (amino acids 1-403) with an N-terminal His-tag .

  • Purification strategy: Affinity chromatography using the His-tag followed by size exclusion chromatography yields highly pure protein suitable for enzymatic assays .

  • Storage conditions: Optimal storage involves lyophilization or maintaining the protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with recommendations to avoid repeated freeze-thaw cycles .

  • Enzymatic activity assays: Several substrate options are available for assessing different aspects of Cdu1 function:

    • Ubiquitin-AMC (Ub-AMC) for measuring general DUB activity

    • Diubiquitin chains for linkage specificity analysis

    • Polyubiquitinated GFP (GFP-Ub) for assessing chain disassembly capability

For researchers working with this protein, reconstitution to 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

How can researchers effectively study the dual enzymatic activities of Cdu1?

Investigating both the deubiquitinase and acetyltransferase functions of Cdu1 requires distinct methodological approaches:

DUB activity assessment:

  • Fluorogenic substrates like Ub-AMC provide quantitative measurement of DUB activity through fluorescence release kinetics .

  • Di- and polyubiquitin chain cleavage assays using defined linkage types (particularly K48 and K63) can be monitored by SDS-PAGE and western blotting to assess linkage preference .

Acetyltransferase activity assessment:

  • Acetylation assays using radiolabeled acetyl-CoA or antibodies specific for acetylated lysine residues.

  • Mass spectrometry to identify acetylation sites on target proteins.

Critical controls:

  • Catalytically inactive mutants should be generated through site-directed mutagenesis of key catalytic residues.

  • Activity assays should be performed under varying conditions (pH, temperature, ionic strength) to determine optimal enzymatic parameters.

  • Substrate specificity should be confirmed using multiple substrate types .

How does Cdu1 contribute to Chlamydia trachomatis infection dynamics?

Cdu1 plays multiple critical roles in supporting C. trachomatis infection through several mechanisms:

  • Protection of bacterial effector proteins: Cdu1's acetylase activity (not its DUB function) protects itself and other bacterial proteins (InaC, IpaM, and CTL0480) from ubiquitin-mediated degradation after their delivery into host cells . This protection is essential for maintaining these proteins' functions within the host cell.

  • Regulation of bacterial exit: Cdu1 and the proteins it protects are required for optimal egress of Chlamydia from host cells, representing a critical stage in the infection cycle . This highlights a coordinated regulation mechanism for secreted effector proteins.

  • Golgi remodeling and host cell survival: Cdu1 promotes Golgi remodeling and survival of infected host cells, presumably by regulating the ubiquitination of both host and bacterial proteins . This modulation of host cellular processes creates a favorable environment for bacterial replication.

These findings collectively demonstrate that Cdu1 employs a non-canonical mechanism to protect virulence factors from degradation after their secretion into host cells, which is essential for maintaining the chlamydial infection .

What host cellular pathways are modulated by Cdu1 during infection?

Cdu1 targets several host cellular pathways to establish a permissive environment for chlamydial infection:

  • Ubiquitin-proteasome system: Through its deubiquitinase activity, Cdu1 can remove ubiquitin from host proteins, potentially preventing their degradation by the proteasome and altering host cell signaling pathways .

  • Protein acetylation networks: The acetyltransferase activity of Cdu1 adds acetyl groups to lysine residues on target proteins, which can alter protein function, stability, and interactions .

  • Vesicular trafficking: Cdu1's role in Golgi remodeling suggests it modulates host membrane trafficking pathways, which is likely important for the formation and maintenance of the pathogen-containing vacuole .

  • Cell death pathways: By promoting survival of infected host cells, Cdu1 likely interferes with apoptotic or other cell death mechanisms that would otherwise eliminate infected cells .

Understanding these interactions is critical for developing potential therapeutic strategies targeting Cdu1 function.

What structural features explain the differential substrate specificity between Cdu1 and Cdu2?

Detailed structural studies have revealed several key differences that explain the divergent substrate specificities of Cdu1 and Cdu2:

  • N-terminal α-helix extension: The most significant structural difference is the presence of an N-terminally extended α-helix in Cdu1 that is absent in Cdu2. This structural element has been directly linked to Cdu1's elevated activity toward poly-ubiquitin chains .

  • Ubiquitin binding interfaces: Despite both enzymes sharing similar binding affinity for distal ubiquitin (consistent with their comparable Ub-AMC activity), differences in residues involved in substrate recognition between the two enzymes affect their processing of longer ubiquitin chains .

  • Additional ubiquitin binding sites: The differential recognition of di- and polyubiquitin chains suggests that Cdu1 contains additional ubiquitin binding sites beyond the primary catalytic domain, enabling it to effectively process these more complex substrates .

These structural distinctions result in substantially different enzymatic activities against complex ubiquitin chain substrates while maintaining similar activity toward simple monoubiquitin substrates, demonstrating a sophisticated evolution of substrate specificity between these paralogous enzymes .

How can researchers design experiments to investigate Cdu1's role in chlamydial egress?

To investigate Cdu1's role in chlamydial egress, researchers should consider a multi-faceted experimental approach:

  • Genetic manipulation strategies:

    • Generate Cdu1-deficient C. trachomatis strains (if technically feasible)

    • Create point mutations that selectively disrupt either the DUB or acetyltransferase activity

    • Use conditional expression systems to control Cdu1 levels at different infection stages

  • Time-course microscopy:

    • Perform live-cell imaging with fluorescently tagged components

    • Use time-lapse microscopy to track the dynamics of bacterial exit

    • Quantify egress events under different conditions

  • Identification of interaction partners:

    • Conduct pulldown assays with purified Cdu1 to identify host and bacterial interaction partners

    • Verify interactions through reciprocal co-immunoprecipitation

    • Map interaction domains through truncation and point mutation analysis

  • Targeted analysis of protected bacterial proteins:

    • Separately investigate the roles of InaC, IpaM, and CTL0480 in egress

    • Monitor their stability and localization in the presence and absence of functional Cdu1

    • Determine if these proteins act independently or coordinately during egress

  • Analysis of key egress-associated events:

    • Calcium flux measurements

    • Cytoskeletal rearrangements

    • Membrane integrity assessments

Through these approaches, researchers can systematically dissect the molecular mechanisms by which Cdu1 and its protected bacterial proteins facilitate the coordinated exit of Chlamydia from host cells.

What challenges exist in studying the physiological substrates of Cdu1?

Several significant challenges complicate the identification and validation of physiological Cdu1 substrates:

  • Temporal dynamics: Substrate interactions may be transient or occur only at specific stages of the infection cycle, making them difficult to capture experimentally.

  • Dual enzymatic activities: Distinguishing between targets of Cdu1's deubiquitinase versus acetyltransferase activities requires careful experimental design and appropriate controls with activity-specific mutants .

  • Subcellular localization constraints: The localization of Cdu1 to the pathogen-containing vacuole means that potential substrates must be accessible in this microenvironment .

  • Host vs. bacterial substrates: Differentiating between host and bacterial protein substrates requires specialized approaches, particularly when similar post-translational modifications exist in both systems.

  • Redundancy and compensation: Other bacterial effectors may have overlapping functions, complicating the interpretation of loss-of-function studies.

Researchers should consider employing:

  • Proximity-based labeling techniques (BioID, APEX)

  • Quantitative proteomics comparing wild-type to catalytically inactive mutants

  • Targeted substrate validation using in vitro and in vivo approaches

  • Temporal profiling of the ubiquitin and acetylation proteomes during infection

How might inhibition of Cdu1 impact Chlamydia trachomatis infection therapeutically?

Targeting Cdu1 presents a promising therapeutic strategy given its essential roles in chlamydial infection:

  • Disruption of bacterial protein protection: Inhibiting Cdu1's acetylase activity would likely lead to degradation of key bacterial effectors (InaC, IpaM, CTL0480), compromising multiple aspects of the infection cycle .

  • Impaired bacterial egress: Evidence shows that Cdu1 is required for optimal egress of Chlamydia from host cells. Inhibiting Cdu1 would likely trap bacteria inside cells, preventing dissemination within the host .

  • Restored host defense mechanisms: By blocking Cdu1's deubiquitinase activity, host ubiquitination-dependent defense pathways might be restored, potentially enhancing clearance of the infection .

  • Potential inhibitor design approaches:

    • Structure-based design targeting the unique N-terminal α-helix of Cdu1

    • Substrate mimetics that block the binding of poly-ubiquitin chains

    • Allosteric inhibitors that prevent conformational changes needed for catalytic activity

  • Developing inhibitors with sufficient specificity

  • Ensuring adequate delivery to the intracellular bacterial compartment

  • Addressing potential toxicity issues

  • Determining the optimal timing of intervention during infection

What techniques are emerging for studying the temporal dynamics of Cdu1 activity during infection?

Several cutting-edge approaches show promise for elucidating the temporal aspects of Cdu1 function:

  • Real-time activity-based probes:

    • Development of fluorescent or bioluminescent sensors that report on Cdu1 enzymatic activity

    • Activity-based probes that covalently label active Cdu1 at different infection stages

  • Optogenetic control systems:

    • Light-inducible expression or inhibition of Cdu1

    • Photocaged inhibitors that can be activated at precise time points

  • Single-cell analysis techniques:

    • Live-cell imaging combined with fluorescent reporters for ubiquitination or acetylation

    • Single-cell proteomics to capture cell-to-cell variation in Cdu1 activity

  • Microfluidic infection models:

    • Controlled infection systems that allow precise manipulation of conditions

    • Real-time monitoring of infection progression correlated with Cdu1 activity

  • CRISPR-based transcriptional reporters:

    • Systems that monitor dynamic changes in gene expression in response to Cdu1 activity

    • Identification of transcriptional signatures indicative of Cdu1 function

These emerging technologies would allow researchers to move beyond static snapshots of Cdu1 function toward a comprehensive understanding of how its activities are coordinated throughout the infection cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.