Recombinant Chlamydia trachomatis serovar L2b Deubiquitinase and deneddylase Dub2 (cdu2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdu2; CTLon_0242; Deubiquitinase and deneddylase Dub2; ChlaDub2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Target Names
cdu2
Target Protein Sequence
MEPIHNPPPQTCSYSRSSTTYTSFKDASCDTKVIRIIIALFLIVISCGLILCAYTFRDLL DADYLAQEGPQQATKLLQQLDDVLTGPPLPIWDNEHLFQFSCLMQNKHKRVLPIDICNPL TKFNFLECICNCLMTKQSVNVNETDMCELFCPPTCTPENYRRLLCTSSVFPFVMWHDPSA DTQEAMLTKMDQTMSSGRVGNSHWVLVIVDIEYRCVTFFDSLCDYVASPQQMREQLEGLA VSLGAIYPKEGGADSDQEELLSPFQVRIGSTVKVQSPGEFTCGAWCCQFLAWYLENPDFD LEEKVPKNPSERRALLADFISTTEQAMSRYSSLSWPTTD
Uniprot No.

Target Background

Function
Effector proteins play a crucial role in altering host cell physiology and promoting bacterial survival within host tissues. This protease exhibits deubiquitinating and deneddylating activities.
Database Links
Protein Families
Peptidase C48 family
Subcellular Location
Secreted. Host cell. Membrane; Single-pass membrane protein.

Q&A

What is Cdu2 and how does it relate to other chlamydial deubiquitinases?

Cdu2 (Chlamydial deubiquitinating enzyme 2) is an enzyme encoded by the cdu2 gene in C. trachomatis that functions as both a deubiquitinase and deneddylase. It appears to be directly downstream of cdu1 in the chlamydial genome with its own transcriptional start site, suggesting independent regulation despite proximity to cdu1 . Unlike Cdu1, which has been shown to interact with and stabilize the host apoptosis regulator Mcl-1 through deubiquitination, Cdu2 does not appear to interact with Mcl-1, indicating a distinct function and substrate specificity . The enzyme is part of C. trachomatis' strategy to modulate host cell processes through manipulation of the ubiquitin system.

How does Cdu2 contribute to chlamydial pathogenesis?

Based on research with related chlamydial deubiquitinases, Cdu2 likely contributes to pathogenesis by targeting specific host proteins for deubiquitination, potentially protecting them from proteasomal degradation. While its exact targets remain under investigation, it may play a role in modulating host immune responses or cellular processes to create a favorable environment for bacterial replication. Transformation systems developed for C. trachomatis, including lambda Red-based recombination approaches, offer promising avenues for creating knockout strains to definitively determine Cdu2's role in infection . Understanding Cdu2's function is particularly important given that L2b strains belong to the lymphogranuloma venereum (LGV) biovar, which has been involved in recent epidemic outbreaks .

What is the evolutionary significance of Cdu2 in different C. trachomatis serovars?

Whole genome analysis of diverse C. trachomatis strains reveals that the LGV clade (which includes serovar L2b) exhibits significantly lower genetic diversity compared to the trachoma lineage . The L2b outbreak strains form a tight cluster with minimal genetic variation (maximum 19 SNPs between the most variant strains), indicating a clonal expansion . This limited diversity suggests that virulence factors like Cdu2 may be highly conserved within the L2b serovar, potentially contributing to its epidemic spread. Comparative analysis of cdu2 across various serovars could provide insights into its evolutionary history and its potential adaptation to different infection niches.

What are the optimal conditions for expressing recombinant Cdu2 protein?

For successful expression of recombinant Cdu2, considerations should include:

  • Expression system selection: E. coli BL21(DE3) or similar strains designed for high-level expression of potentially toxic proteins are recommended.

  • Codon optimization: C. trachomatis uses a different codon bias than E. coli; therefore, codon optimization of the cdu2 gene for E. coli expression is advisable.

  • Fusion tags: A 6xHis tag or similar affinity tag is recommended for purification, with optional use of solubility-enhancing tags like MBP if Cdu2 shows poor solubility.

  • Expression conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) may improve soluble protein yield by slowing production and allowing proper folding.

  • Buffer optimization: Inclusion of stabilizing agents (5-10% glycerol, 1-5 mM DTT) can help maintain enzyme activity during purification.

This methodology draws from similar approaches used for Cdu1 expression, where structural characterization revealed similarity to mammalian deubiquitinases with unique structural features including a distinctive α-helix near the substrate-binding pocket .

How can the lambda Red system be adapted for targeted modification of the cdu2 gene?

The lambda Red recombineering system recently developed for Chlamydia can be adapted for cdu2 modification through the following steps:

  • Design a non-replicative plasmid encoding lambda Red components (exo, bet, gam) under control of a chlamydial promoter.

  • Create targeting sequences flanking a selection marker (e.g., chloramphenicol resistance) that are homologous to regions upstream and downstream of cdu2.

  • Transform C. trachomatis using the calcium chloride method, combining plasmid DNA with infectious elementary bodies in CaCl₂ buffer before adding to host cells .

  • Selection process: Apply antibiotic selection (starting with lower concentrations and gradually increasing) through multiple passages to isolate modified organisms.

  • Verification: Confirm gene deletion/modification through PCR genotyping and whole genome sequencing .

The efficiency of this system has been demonstrated for various gene targets in C. trachomatis L2/434 with successful mutants recovered within 2-3 rounds of selection . Importantly, this system allows for both single gene deletions and multiple gene modifications, making it suitable for complex genetic analysis of cdu2 function.

What are effective approaches for confirming Cdu2 deubiquitinase activity in vitro?

To confirm and characterize Cdu2 deubiquitinase activity, the following methodological approaches are recommended:

  • Fluorogenic substrate assay: Utilize Ub-AMC (ubiquitin-7-amino-4-methylcoumarin) as a fluorogenic substrate, measuring increased fluorescence upon cleavage by Cdu2.

  • Di-ubiquitin cleavage assay: Assess Cdu2's ability to cleave different di-ubiquitin linkages (K48, K63, etc.) using purified di-ubiquitin chains and SDS-PAGE analysis.

  • Ubiquitinated protein substrate assay: Test activity against physiologically relevant ubiquitinated proteins isolated from host cells.

  • Inhibitor profiling: Characterize sensitivity to various DUB inhibitors to classify the enzyme mechanistically.

  • Mutational analysis: Create active site mutants (based on homology modeling) to confirm catalytic residues.

Similar approaches have been used to characterize Cdu1, which revealed substantial deubiquitinating activity with specificity for certain substrates . Comparative analysis between Cdu1 and Cdu2 activities would provide valuable insights into their complementary roles during infection.

What imaging techniques best visualize Cdu2 localization during infection?

For optimal visualization of Cdu2 localization during C. trachomatis infection:

  • Immunofluorescence microscopy with co-localization markers:

    • Generate specific antibodies against recombinant Cdu2

    • Co-stain with inclusion membrane markers (e.g., IncA)

    • Co-stain with host cell compartment markers

  • Recombinant FLAG-tagged Cdu2 expression:

    • Create recombinant C. trachomatis expressing FLAG-tagged Cdu2 under native promoter control

    • Detect using anti-FLAG antibodies for highly specific visualization

  • Super-resolution microscopy techniques:

    • Stimulated emission depletion (STED) microscopy

    • Structured illumination microscopy (SIM)

    • Single-molecule localization microscopy (PALM/STORM)

  • Live-cell imaging:

    • Create fluorescent protein fusions (if functionality is maintained)

    • Monitor dynamics of Cdu2 localization throughout the developmental cycle

This approach draws from successful localization studies of Cdu1, which was found to localize to the inclusion membrane facing the cytosol, positioning it to interact with host cytoplasmic proteins .

How can host cell targets of Cdu2 be identified and validated?

A comprehensive approach to identifying Cdu2 host targets includes:

  • Proximity-based labeling:

    • Express BioID or TurboID-fused Cdu2 in infected cells

    • Purify biotinylated proteins and identify by mass spectrometry

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Pull down FLAG-tagged Cdu2 from infected cells

    • Identify interacting partners by mass spectrometry

  • Comparative ubiquitinome analysis:

    • Compare ubiquitinated proteins in wild-type vs. Cdu2-deficient infection

    • Use SILAC or TMT labeling for quantitative proteomics

  • Validation approaches:

    • Direct binding assays with recombinant proteins

    • In vitro deubiquitination assays with purified substrates

    • Creation of substrate mutants resistant to Cdu2 action

    • Rescue experiments in cells infected with Cdu2-deficient strains

This methodology was successfully employed for Cdu1, leading to the identification of Mcl-1 as a specific target that is stabilized by deubiquitination during infection . The distinct substrate profile of Cdu2 would provide insights into its unique function.

What in vivo models best demonstrate the role of Cdu2 in pathogenesis?

Based on research with other chlamydial virulence factors, the following in vivo models are recommended:

  • Mouse genital tract infection model:

    • Intravaginal infection with wild-type vs. Cdu2-deficient C. trachomatis

    • Assessment of bacterial burden, course of infection, and immune response

    • Quantification of pathology (hydrosalpinx formation, inflammatory markers)

  • Transcervical infection model:

    • Direct inoculation of the upper genital tract to assess role in upper tract pathology

    • Particularly relevant for LGV strains like L2b

  • Cell-type specific responses:

    • Ex vivo infection of relevant primary cells (epithelial cells, macrophages)

    • Analysis of differential responses to wild-type vs. Cdu2-deficient strains

Similar approaches with Cdu1-deficient strains have demonstrated increased sensitivity to IFNγ and impaired infection in mice, indicating the importance of deubiquitinating enzymes in chlamydial pathogenesis . The mouse infection model is particularly valuable as it has been successfully used to demonstrate significant effects of genetic disruption on in vivo infection, with over a log-fold decrease in bacterial burden observed for certain mutants .

How should researchers analyze differential gene expression in cells infected with Cdu2-deficient C. trachomatis?

For robust analysis of differential gene expression:

  • Experimental design considerations:

    • Include appropriate time points (early, middle, late infection)

    • Use biological replicates (minimum n=3)

    • Include uninfected controls and wild-type infected comparisons

  • RNA-seq analysis pipeline:

    • Quality control: FastQC for raw reads

    • Alignment: HISAT2 or STAR against human reference genome

    • Quantification: featureCounts or HTSeq

    • Differential expression: DESeq2 or edgeR

  • Analysis parameters:

    Analysis StageRecommended Parameters
    Quality filteringQ>30, adapter removal
    AlignmentAllow for 2 mismatches, discard multi-mapping reads
    Differential expressionAdjusted p-value <0.05, log₂FC >1 or <-1
    Pathway analysisGSEA, IPA, or Reactome with FDR <0.1
  • Validation approaches:

    • RT-qPCR for selected genes

    • Protein-level validation by immunoblotting

    • Functional assays for key pathways identified

When interpreting results, consideration should be given to the temporal dynamics of chlamydial gene expression and the potential indirect effects due to altered developmental cycle progression in mutant strains.

What statistical approaches should be used when comparing wild-type and cdu2-modified strains?

Appropriate statistical analysis should include:

  • For continuous variables (bacterial load, protein levels):

    • Test for normality (Shapiro-Wilk)

    • For normally distributed data: t-test (two groups) or ANOVA (multiple groups)

    • For non-normal data: Mann-Whitney U (two groups) or Kruskal-Wallis (multiple groups)

  • For survival or time-course experiments:

    • Kaplan-Meier analysis with log-rank test

    • Mixed-effects models for repeated measures

  • Sample size determination:

    Expected Effect SizeRecommended Minimum Sample Size
    Large (d>0.8)n=10 per group
    Medium (d=0.5)n=25 per group
    Small (d=0.2)n=64 per group
  • Multiple testing correction:

    • Bonferroni for small number of planned comparisons

    • Benjamini-Hochberg FDR for large-scale analyses (proteomics, transcriptomics)

  • Reporting recommendations:

    • Include exact p-values rather than thresholds

    • Report confidence intervals

    • Include effect sizes alongside significance values

This approach ensures robust detection of phenotypic differences while minimizing false discoveries, critical when characterizing subtle effects of deubiquitinase activity on host-pathogen interactions.

What are the major technical challenges in creating stable cdu2 knockout strains?

Creating stable cdu2 knockout strains faces several challenges:

  • Essential gene considerations:

    • If cdu2 is essential, complete deletion may not be viable

    • Conditional knockdown systems may be required

    • Partial gene deletions preserving adjacent genes must be designed carefully

  • Genetic stability issues:

    • Chlamydia may revert mutations during passage

    • Careful selection pressure maintenance is required

  • Polar effects on neighboring genes:

    • As cdu2 appears downstream of cdu1, deletions could affect transcription

    • Design must ensure cdu2 has its own transcriptional start site preserved

  • Technical optimization needs:

    • Transformation efficiency remains relatively low

    • Multiple rounds of selection are typically required

    • Clonal isolation is challenging due to chlamydial growth characteristics

For addressing these challenges, the lambda Red system offers advantages over traditional approaches, as it has demonstrated successful deletion of multiple genes in C. trachomatis L2 and C. muridarum .

How might Cdu2 function differ between LGV (L2b) and non-LGV serovars?

The functional differences of Cdu2 between LGV and non-LGV serovars may include:

  • Substrate specificity variations:

    • LGV strains infect lymphatic tissue, potentially requiring distinct host targets

    • Differences in enzyme activity or substrate recognition could contribute to tissue tropism

  • Expression pattern differences:

    • Temporal expression may vary between serovars

    • Protein levels may be differently regulated

  • Structural variations:

    • Amino acid differences may alter substrate binding pocket architecture

    • Post-translational modifications may differ between serovars

  • Evolutionary considerations:

    • LGV strains show lower genetic diversity than urogenital strains

    • The L2b epidemic strain represents a clonal outbreak with minimal variation

    • Conserved features in L2b Cdu2 may contribute to enhanced virulence

Comparative studies using recombinant enzymes from different serovars, coupled with cross-complementation experiments, would help elucidate these differences and their contribution to disease presentation.

What are promising strategies for developing inhibitors against Cdu2?

Development of Cdu2 inhibitors could follow these strategic approaches:

  • Structure-based drug design:

    • Solve crystal structure of Cdu2 catalytic domain

    • Identify unique features compared to human DUBs

    • Use in silico screening of compound libraries

  • High-throughput screening approaches:

    • Develop fluorescence-based activity assays suitable for HTS

    • Screen diverse chemical libraries

    • Include counter-screens against human DUBs for selectivity

  • Fragment-based drug discovery:

    • Identify small molecular fragments that bind to Cdu2

    • Optimize and link fragments to improve potency and selectivity

  • Evaluation parameters:

    ParameterTarget Value
    IC₅₀<1 μM against recombinant enzyme
    Selectivity>10-fold vs. human DUBs
    Cellular activityEffective at <10 μM in infection models
    ADME propertiesSuitable for in vivo testing
  • Validation approaches:

    • Test in cellular infection models

    • Assess effects on chlamydial growth and development

    • Compare to genetic knockout phenotypes

This approach leverages the structural uniqueness of bacterial deubiquitinases compared to their human counterparts, as demonstrated by the identification of a distinctive α-helix near the substrate-binding pocket in Cdu1 .

What are the most promising research directions for understanding Cdu2 function?

The most promising research directions include:

  • Comprehensive substrate identification:

    • Global proteomics approaches to identify all potential Cdu2 targets

    • Determination of ubiquitin chain linkage specificity

  • Structural biology approaches:

    • Crystal or cryo-EM structure determination

    • Structure-function analysis of enzyme mechanisms

  • Systems biology integration:

    • Network analysis of Cdu2 within the context of other chlamydial effectors

    • Temporal mapping of Cdu2 activity throughout the developmental cycle

  • Translational applications:

    • Exploration of Cdu2 as a biomarker for LGV infections

    • Assessment of Cdu2 as a vaccine target

These directions build on the foundation established by studies of Cdu1 and other chlamydial effectors, while leveraging new genetic tools like the lambda Red system that facilitate previously challenging genetic manipulations in Chlamydia .

How might understanding Cdu2 contribute to broader knowledge of bacterial pathogenesis?

Understanding Cdu2 contributes to bacterial pathogenesis knowledge through:

  • Novel mechanisms of immune evasion:

    • Deubiquitination as a strategy to modulate host defense

    • Potential interference with innate immune signaling pathways

  • Evolutionary insights:

    • Acquisition of eukaryotic-like enzymes by bacterial pathogens

    • Adaptation of these enzymes for specific host interactions

  • Convergent pathogenic strategies:

    • Comparison with deubiquitinases from other intracellular pathogens

    • Identification of common targets across diverse bacteria

  • Host-pathogen interface dynamics:

    • Understanding of the inclusion membrane as a signaling interface

    • Mechanisms by which bacteria manipulate host processes from a vacuolar compartment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.