Recombinant Chlamydia trachomatis serovar L2b Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Lipoprotein signal peptidase (lspA) is an essential enzyme (EC 3.4.23.36) in C. trachomatis responsible for cleaving signal peptides from prolipoproteins, enabling their maturation and integration into bacterial membranes . The recombinant form, expressed in Escherichia coli, retains this enzymatic activity and is utilized for immunological and biochemical assays .

Key features include:

  • Gene locus: CTLon_0661 in C. trachomatis serovar L2b (strain UCH-1/proctitis) .

  • Protein length: 167 amino acids, with a molecular weight of approximately 19 kDa .

  • Operonic context: Located downstream of nrdR (regulator of nucleotide biosynthesis) and dksA (transcription factor), forming a polycistronic mRNA cluster critical for developmental regulation .

Table 1: Physicochemical Properties of Recombinant lspA

ParameterDetails
Expression systemE. coli
TagDetermined during production (e.g., His-tag)
Storage bufferTris-HCl (pH 8.0), 1.5 M urea, 50% glycerol
StabilityStable at -20°C long-term; working aliquots stable at 4°C for 7 days
SequenceMPTRSLPTFLTLLLLASIDWVSKLVVLLKSCQLSPHSSAFLYSYVWGHFSFLIIPSFNEG...

The enzyme adopts a structure homologous to other bacterial signal peptidases, featuring a conserved catalytic domain critical for substrate recognition .

Research Applications

Recombinant lspA is primarily employed in:

  • ELISA development: Used as an antigen to detect anti-C. trachomatis antibodies in patient sera .

  • Functional studies: Investigating its role in bacterial lipoprotein processing and membrane biogenesis .

  • Vaccine research: Explored alongside other chlamydial antigens (e.g., MOMP, HSP70) for subunit vaccine formulations .

Challenges and Future Directions

While recombinant lspA is a valuable reagent, limitations include:

  • Structural ambiguity: No resolved 3D structure to guide inhibitor design .

  • Immunological relevance: Lower diagnostic sensitivity compared to antigens like Pgp3 or TmeA .
    Future studies should prioritize structural elucidation and evaluation of lspA as a component of multi-antigen vaccines .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; CTLon_0661; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Target Names
lspA
Target Protein Sequence
MPTRSLPTFLTLLLLASIDWVSKLVVLLKSCQLSPHSSAFLYSYVWGHFSFLIIPSFNEG AAFGLFAQYKIPLLIFRVCVILGLALFLRIKYKSLHRRTRIALTLILAGALGNVGDILLH GKVVDFLFLSYYSWRFPSFNLADAFISIGTLLLIGHLYFNKESKKCF
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of lspA in Chlamydia trachomatis serovar L2b?

The lspA gene in C. trachomatis is part of a polycistronic operon that includes nrdR (encoding a negative regulator of deoxyribonucleotide biosynthesis) and dksA (encoding an RNA polymerase-binding transcription factor). Genomic analyses reveal that lspA is approximately 504 bp in size and is positioned downstream of dksA in this operon . The entire operon structure spans approximately 1477 bp from the transcription start site (TSS) of nrdR to the stop codon of lspA . Northern blot analyses have demonstrated that this region produces two distinct transcripts: a more abundant 1.0 kb transcript and a less abundant 1.5 kb transcript, suggesting complex transcriptional regulation of these genes .

What is the role of lspA in the chlamydial developmental cycle?

Lipoprotein signal peptidase (lspA) plays a critical role in processing bacterial lipoproteins by cleaving the signal peptide after lipid modification. In C. trachomatis, which undergoes a biphasic developmental cycle transitioning between reticulate body (RB) and elementary body (EB) forms, lspA likely functions in the maturation of membrane lipoproteins essential for bacterial development and virulence . The expression pattern of genes in the nrdR-dksA-lspA operon correlates with critical transition points in the chlamydial developmental cycle, particularly during the RB-to-EB conversion process that begins approximately 18-20 hours post-infection (hpi) . This timing suggests lspA's potential involvement in membrane remodeling processes required for the production of infectious EBs.

How does the expression of lspA vary during C. trachomatis infection?

RNA-Seq analysis of the transcriptional profile during C. trachomatis infection demonstrates that lspA expression follows a temporal pattern similar to other genes involved in the developmental cycle . While the search results provide more detailed expression data for dksA than specifically for lspA, the organization of these genes in an operon suggests coordinated expression. Transcriptional studies have shown that the nrdR-dksA-lspA region is characterized by tandem promoters, suggesting that lspA expression might be regulated both as part of the entire operon and potentially from an independent promoter within the operon . This complex regulation may allow fine-tuned expression of lspA at critical phases of the developmental cycle.

What methodologies can be used to express and purify recombinant C. trachomatis lspA?

Recommended methodological approach for recombinant lspA expression:

  • Gene Synthesis and Optimization: Synthesize codon-optimized lspA sequence based on the C. trachomatis serovar L2b genome. Codon optimization should account for the expression host (typically E. coli).

  • Vector Selection: For bacterial expression, pET-based vectors with histidine or other affinity tags are recommended. Include a protease cleavage site if tag removal is desired for functional studies.

  • Expression Systems:

    • Bacterial: BL21(DE3) or derivatives for standard expression; C41/C43(DE3) strains for membrane proteins

    • Consideration for detergent solubilization may be necessary due to lspA's membrane-associated nature

  • Purification Strategy:

    StepMethodConsiderations
    Initial captureIMAC (Ni-NTA)Low imidazole wash to reduce non-specific binding
    Intermediary purificationIon exchange chromatographySelect based on theoretical pI of lspA
    PolishingSize exclusion chromatographyAssess oligomeric state, remove aggregates
    Detergent exchangeIf needed for structural studiesReplace harsh extraction detergents with milder ones
  • Activity Verification: Develop an in vitro assay using synthetic peptide substrates containing the lipobox motif to confirm enzymatic activity of purified recombinant lspA .

What are the most effective methods for studying lspA function in C. trachomatis?

Due to the obligate intracellular lifestyle of C. trachomatis, creative approaches are needed to study lspA function:

  • Inducible Expression Systems: Utilize the theophylline-responsive riboswitch system developed for Chlamydia to control lspA expression during infection. Similar to studies with dksA in C. trachomatis, the p2TK2-SW2 or pBOMB4 vectors with E-Riboswitch could be used for temporal control of lspA expression .

  • Functional Complementation: Test whether C. trachomatis lspA can functionally complement lspA mutations in other bacterial systems like E. coli, similar to approaches used with DksA .

  • Targeted Mutagenesis: Generate specific mutations in conserved catalytic residues of lspA and assess their effects on protein function and chlamydial development.

  • Co-expression Studies: Investigate potential interactions between lspA and other membrane-processing machinery by co-expression studies.

  • Proteomic Analysis: Use comparative proteomics to identify changes in the lipoprotein profile when lspA expression is altered, highlighting substrates and pathways affected by lspA activity.

Data from these approaches should be integrated with developmental cycle analysis measuring both genome equivalents (GE) and inclusion forming units (IFU) to assess effects on bacterial replication and infectious progeny formation, similar to methods used in dksA studies .

How does lspA contribute to the pathogenesis of C. trachomatis serovar L2b infections?

C. trachomatis serovar L2b is associated with lymphogranuloma venereum (LGV) and has emerged as a significant pathogen causing atypical clinical presentations, particularly proctitis in men who have sex with men (MSM) . As a lipoprotein signal peptidase, lspA likely processes virulence-associated lipoproteins that contribute to the unique tissue tropism and pathogenicity of this serovar.

Recent outbreak analysis identified a novel L2b strain with a chimeric genome structure due to genetic transfer, potentially altering its virulence profile . The processing of lipoproteins by lspA may influence:

  • Immune Recognition: Properly processed lipoproteins serve as pathogen-associated molecular patterns (PAMPs) that interact with host Toll-like receptors (TLRs), particularly TLR2.

  • Membrane Integrity: Lipoproteins contribute to bacterial membrane structure, potentially affecting resistance to host defense mechanisms.

  • Host-Pathogen Interactions: Surface-exposed lipoproteins may mediate attachment, invasion, and manipulation of host cell processes.

  • Developmental Transitions: Proper processing of lipoproteins by lspA may be crucial for RB-to-EB transitions, which occur at approximately 18 hours post-infection .

The temporal expression of genes in the lspA-containing operon correlates with critical developmental transitions in C. trachomatis, suggesting that lspA may play a role in the morphological conversion process necessary for producing infectious elementary bodies .

How do specific mutations in lspA affect C. trachomatis developmental cycle and virulence?

Based on the research methodologies used to study related genes in C. trachomatis, the effects of lspA mutations could be investigated through:

  • Site-Directed Mutagenesis: Target conserved catalytic residues (typically serine and lysine in lipoprotein signal peptidases).

  • Expression Analysis: Use the theophylline-inducible riboswitch system to express mutant versions of lspA at specific time points during infection .

  • Phenotypic Measurements:

    ParameterMethodologyExpected Impact of lspA Mutation
    Bacterial replicationGenome equivalent (GE) measurementPotential reduction in bacterial numbers
    EB formationInclusion forming unit (IFU) assayExpected decrease in infectious progeny
    Inclusion morphologyImmunofluorescence microscopyPotential abnormalities in inclusion size/shape
    Lipoprotein processingWestern blot analysisAccumulation of unprocessed lipoprotein precursors
  • Complementation Studies: Assess whether wild-type lspA can rescue phenotypic defects when co-expressed with mutant versions.

What is the relationship between lspA and antimicrobial resistance in C. trachomatis?

While the search results don't directly address antimicrobial resistance in relation to lspA, several research considerations emerge:

  • Persistent Infection Models: Evaluate how alterations in lspA expression affect the development of persistence (a state of reduced metabolic activity and altered morphology) in response to antibiotics.

  • Membrane Permeability: Investigate whether lspA-processed lipoproteins influence membrane properties that affect antibiotic penetration.

  • Stress Response Connection: The operon containing lspA includes dksA, which is associated with bacterial stress responses . This suggests potential coordination between lipoprotein processing and stress adaptation mechanisms that might influence antibiotic tolerance.

  • Target for Novel Therapeutics: Bacterial lipoprotein signal peptidases are absent in humans, making them potential targets for new antimicrobial compounds. Recombinant lspA could be used in high-throughput screening assays to identify inhibitory compounds.

How does C. trachomatis lspA structure compare to lipoprotein signal peptidases in other bacteria?

Structural analysis of C. trachomatis lspA would typically involve:

  • Sequence Alignment: Compare C. trachomatis lspA sequence with characterized lipoprotein signal peptidases from other bacteria to identify conserved catalytic residues and structural motifs.

  • Homology Modeling: Generate a structural model based on crystal structures of lipoprotein signal peptidases from other bacteria (generally type II signal peptidases are membrane proteins with several transmembrane domains).

  • Active Site Analysis: Identify residues in the predicted active site and compare with known mechanistic details from other bacterial LspA proteins.

  • Membrane Topology Prediction: Analyze the hydrophobicity profile to predict transmembrane domains and membrane association.

Expected structural features would include:

  • Multiple transmembrane domains

  • Conserved catalytic serine and lysine residues in the active site

  • Aspartic acid residues that may contribute to the catalytic mechanism

  • Structural adaptations specific to the chlamydial intracellular lifestyle

What are the differences in lspA between various C. trachomatis serovars?

C. trachomatis strains are classified according to their ompA genotypes, which correlate with different tissue tropisms and disease outcomes (ocular disease, urogenital disease, and lymphogranuloma venereum) . A comparative analysis of lspA across these serovars would investigate:

  • Sequence Conservation: Determine the degree of lspA sequence conservation across serovars, particularly between those with different tissue tropism.

  • Expression Patterns: Compare expression timing and levels of lspA between serovars during infection.

  • Substrate Specificity: Investigate whether lspA from different serovars exhibits preferences for processing different lipoprotein substrates.

  • Functional Complementation: Test whether lspA from one serovar can functionally replace lspA from another serovar.

This comparative approach could reveal adaptations in lipoprotein processing that contribute to the distinct pathogenic properties of different C. trachomatis serovars, including the L2b serovar associated with the LGV epidemic .

How might lspA function be studied in the context of C. trachomatis persistence?

C. trachomatis can enter a persistent state characterized by altered metabolism and morphology when exposed to certain stressors. Studying lspA in this context would involve:

  • Induction of Persistence: Use established methods (IFN-γ, β-lactam antibiotics, or nutrient deprivation) to induce persistence.

  • Expression Analysis: Measure lspA expression during entry into persistence, maintenance of the persistent state, and reactivation.

  • Conditional Expression: Use the theophylline-inducible system to alter lspA expression during various phases of persistence .

  • Lipoprotein Profile Analysis: Compare the lipoprotein processing patterns between normal and persistent forms.

  • Membrane Structure Studies: Investigate changes in membrane properties that might correlate with altered lspA activity during persistence.

This research direction could provide insights into how C. trachomatis adapts its membrane composition during stress responses and persistence, potentially revealing new therapeutic targets.

What role might lspA play in the unique chimeric genome structure of emerging C. trachomatis strains?

Recent research has identified a C. trachomatis L2b strain with a chimeric genome structure resulting from genetic transfer, which exhibited altered clinical presentation . Investigating lspA in this context:

  • Comparative Genomics: Analyze the lspA sequence and surrounding genomic regions in chimeric strains compared to traditional strains.

  • Expression Studies: Determine whether genetic recombination events affect lspA expression patterns or regulation.

  • Functional Analysis: Assess whether lspA from chimeric strains exhibits altered substrate specificity or catalytic efficiency.

  • Host-Pathogen Interaction: Investigate whether altered lspA function in chimeric strains affects immune recognition or pathogenicity.

This research would contribute to understanding how genomic recombination events in C. trachomatis impact protein function and potentially explain the "modified transmission, tissue tropism and pathogenic capabilities" observed in these variant strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.