Recombinant Chlamydia trachomatis Uncharacterized protein CT_006 (CT_006)

Shipped with Ice Packs
In Stock

Description

Introduction to CT_006

CT_006 is a 189-amino-acid protein embedded in the inclusion membrane of C. trachomatis, a pathogen responsible for sexually transmitted infections and trachoma . While classified as "uncharacterized," recent studies reveal its association with lipid droplets (LDs) and the endoplasmic reticulum (ER) in host cells . Recombinant CT_006 enables functional studies without requiring live C. trachomatis cultures.

Domain Architecture

CT_006 contains:

  • Amino-terminal region (1–88 aa): Mediates LD targeting via positively charged residues .

  • Central bilobed hydrophobic domain (89–140 aa): Characteristic of Inc proteins; anchors CT_006 to the inclusion membrane .

  • Carboxy-terminal region (139–189 aa): Cytosol-exposed; potential interaction site for host factors .

Recombinant Production

A commercially available recombinant CT_006 (Creative Biomart, Cat. No. RFL26427CF) includes:

ParameterDescription
HostEscherichia coli
TagN-terminal His tag
Sequence CoverageFull length (1–189 aa; Uniprot ID: O84009)
Molecular Weight~23 kDa (predicted)
ApplicationsAntibody development, protein interaction studies, LD association assays

Lipid Droplet Association

  • Ectopic expression of CT_006 fragments in yeast and HeLa cells shows:

    • CT_006<sub>1–88</sub> co-localizes with LDs and ER .

    • Positively charged residues (e.g., Arg<sup>5</sup>, Lys<sup>7</sup>) in the amino-terminal region are critical for LD targeting .

Inclusion Membrane Dynamics

  • Localization: CT_006 accumulates at the inclusion membrane during infection .

  • Host Exposure: Both amino- and carboxy-terminal regions are exposed to the host cytosol, enabling interactions with LD-associated proteins .

Functional Mutant Analysis

  • CT_006 Overexpression: A C. trachomatis strain overproducing CT_006-2HA showed a 12–15% increase in LD area within inclusion regions .

  • Mutant Phenotypes:

    • Deletion of residues 47–67 (putative hydrophobic region) disrupted LD targeting in transfected cells .

    • Substitution of five glycine residues in CT_006<sub>1–88</sub> abolished LD association .

Essentiality Challenges

  • Attempts to generate a ct006 knockout strain via group II intron mutagenesis or FRAEM failed, suggesting ct006 may be essential for C. trachomatis viability .

Functional Domains of CT_006

RegionFunctionKey ResiduesCitation
1–88 aaLD and ER targetingArg<sup>5</sup>, Lys<sup>7</sup>
89–140 aaInclusion membrane insertionTyrosine<sup>89</sup>
139–189 aaHost cytosol exposureHistidine<sup>140</sup>

Discussion and Implications

CT_006 is a multifunctional Inc protein that likely facilitates nutrient acquisition by recruiting host LDs to the inclusion . Its recombinant form provides a tool to dissect LD-pathogen interactions without biosafety constraints. Future work should prioritize:

  1. CRISPR-based knockdown to confirm essentiality.

  2. Proteomic screens to identify host LD proteins interacting with CT_006.

  3. Structural studies to resolve its membrane topology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a particular tag type, please specify this in your order for prioritized development.
Synonyms
CT_006; Uncharacterized protein CT_006
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
CT_006
Target Protein Sequence
MPSTVAPIKGQDHFLNLVFPERVAAAYMSPLAQKYPKAALSIASLAGFLLGILKLITFPV LCAAGLFVFPIRGLISCLFHKSFQGCSGYVLATFLSLFSLALTIVGIVSCITWAPGFIFP MISVSIAFATVETCFQIYTHLFPALEHKPSSSLKIEIAAAKLPRSSSAPDLNYPSLPTQS ASPSQRFSA
Uniprot No.

Target Background

Database Links

KEGG: ctr:CT_006

Protein Families
Chlamydial CPn_0442/CT_006/TC_0274 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the CT006 protein?

CT006 consists of 189 amino acid residues with several distinct domains. Its structure includes a characteristic bilobed hydrophobic motif between tyrosine residue 89 and histidine residue 140, comprised of two transmembrane segments separated by a loop of 6 residues . Additionally, CT006 contains another hydrophobic domain between glycine residue 47 and phenylalanine residue 69 that is predicted to be transmembrane but appears to be exposed to the host cytosol . When inserted into the inclusion membrane, both the amino-terminal (residues 1-88) and carboxy-terminal regions are exposed to the host cell cytosol, while the central bilobed domain anchors the protein in the inclusion membrane .

How does CT006 localize within infected cells?

During C. trachomatis infection, CT006 is delivered into host cells from at least 2 hours post-infection and accumulates at the inclusion membrane throughout the developmental cycle . Immunofluorescence microscopy confirms that CT006 concentrates at the inclusion membrane and co-localizes with other inclusion membrane proteins like Cap1 . At approximately 8 hours post-infection, CT006 has been observed in small tubules near the inclusion, suggesting these structures may be extensions of the vacuolar membrane . This localization pattern is consistent with its classification as a bona fide inclusion membrane protein (Inc) .

What evidence supports CT006's association with lipid droplets?

When the first 88 amino acids of CT006 are ectopically expressed in eukaryotic cells including HeLa cells and Saccharomyces cerevisiae, they demonstrate tropism for lipid droplets . This association was revealed through fluorescence microscopy experiments using CT006 fragments fused to monomeric enhanced green fluorescent protein (mEGFP) . Cells infected with C. trachomatis strains overproducing CT006-2HA showed a slight but significant increase in the area of lipid droplets within the inclusion region compared to cells infected with the parental strain, providing additional evidence for CT006's role in lipid droplet interactions .

What methods are effective for studying CT006 localization?

Several complementary approaches have proven effective for studying CT006 localization. Fluorescence microscopy using fusion proteins (CT006-mEGFP or mEGFP-CT006) allows visualization of CT006 localization in transfected cells . For studying localization during actual infection, generating C. trachomatis strains producing tagged versions of CT006 (such as CT006-2HA) enables tracking of the protein throughout the infection cycle .

The GSK tag phosphorylation system provides a powerful method to determine which regions of CT006 are exposed to the host cytosol. This technique involves fusing a 13-residue phosphorylatable peptide from glycogen synthase kinase (GSK)-3β to different regions of CT006, transforming C. trachomatis with these constructs, and then detecting phosphorylation using phospho-specific GSK antibodies . Phosphorylation indicates exposure to host cell cytosolic kinases, confirming cytosolic localization of the tagged domain .

How can researchers generate modified C. trachomatis strains to study CT006?

Researchers can transform C. trachomatis with plasmids encoding modified versions of CT006 under the control of appropriate promoters. For instance, to study CT006 during infection, a strain harboring plasmid-encoded CT006 with a double hemagglutinin (2HA) tag (CT006-2HA) under the control of the ct006 promoter can be generated . This approach typically results in approximately 10-fold increase in total mRNA and protein levels relative to endogenous expression, providing sufficient signal for detection while maintaining physiological relevance .

For studying the functional significance of specific protein domains, researchers can generate strains expressing mutant versions of CT006, such as CT006 5G-2HA (with positively charged residues mutated to glycine) or CT006 Δ47-67-2HA (with deletion of the putative hydrophobic domain) . Each construct should be confirmed for expression and proper localization using immunoblotting and immunofluorescence microscopy .

What analytical approaches can quantify CT006's impact on lipid droplet distribution?

To analyze CT006's impact on lipid droplet distribution, researchers can employ oleic acid treatment to enhance lipid droplet formation, followed by fluorescence microscopy using neutral lipid dyes like Bodipy 493/503 . Quantitative analysis can be performed by measuring the area of lipid droplets within the inclusion region from randomly selected microscopy images .

The analytical workflow includes:

  • Infecting cells with wild-type and CT006-modified C. trachomatis strains

  • Treating cells with oleic acid (typically for 6 hours)

  • Fixing cells at various time points post-infection

  • Co-staining with anti-chlamydial antibodies (e.g., anti-Hsp60) to visualize inclusions and Bodipy 493/503 to visualize lipid droplets

  • Collecting random images through fluorescence microscopy

  • Measuring the area of Bodipy-positive structures within the inclusion region using image analysis software

  • Performing statistical analysis to determine significant differences between strains

How do the specific amino acid sequences within CT006 contribute to lipid droplet targeting?

The first 88 amino acid residues of CT006 are sufficient for lipid droplet targeting when expressed ectopically in eukaryotic cells . Within this region, positively charged residues flanking the hydrophobic domain between G47 and F69 are particularly important for lipid droplet association . Mutation of these positively charged residues to glycine (creating CT006 5G) abolishes the lipid droplet association in transfected cells .

The exact mechanism of this targeting remains unclear, but it likely involves electrostatic interactions between the positively charged residues and the negatively charged phospholipid monolayer surrounding lipid droplets . Further research using site-directed mutagenesis of individual residues could elucidate which specific amino acids are most critical for this targeting function. Additionally, structural studies examining the conformation of this region when interacting with lipid droplets would provide valuable insights into the molecular mechanism of targeting.

What is the functional significance of CT006's dual tropism for endoplasmic reticulum and lipid droplets?

CT006 displays tropism for both the endoplasmic reticulum (ER) and lipid droplets when expressed in eukaryotic cells . This dual tropism may reflect CT006's biological function, as lipid droplets originate from the ER. The protein might participate in exploiting the continuity between these organelles to facilitate lipid acquisition by C. trachomatis .

To investigate this functional relationship, researchers should consider:

  • Performing live-cell imaging to track CT006-mediated interactions between the inclusion, ER, and lipid droplets

  • Using proximity labeling techniques (BioID or APEX) to identify proteins that interact with CT006 at the ER-lipid droplet interface

  • Examining changes in lipid composition of the inclusion membrane in cells infected with CT006-overexpressing versus CT006-mutant strains

  • Evaluating the impact of disrupting ER-lipid droplet contacts on CT006 localization and function

How does CT006 integrate with other chlamydial effectors in manipulating host lipid metabolism?

C. trachomatis employs multiple strategies to acquire host lipids, likely involving several effector proteins working in concert. The role of CT006 within this larger network remains to be fully elucidated . Several research approaches could address this question:

  • Perform comparative proteomics of lipid droplets isolated from cells infected with wild-type C. trachomatis versus CT006-overexpressing or CT006-mutant strains

  • Conduct genetic interaction studies by generating C. trachomatis strains with modifications in multiple lipid-associated effectors

  • Use systems biology approaches to map the temporal dynamics of different effectors' activities throughout the developmental cycle

  • Employ lipidomics to characterize changes in lipid composition of the inclusion membrane and bacterial cells in response to CT006 manipulation

What are the technical limitations in generating CT006 knockout strains?

Attempts to generate C. trachomatis ct006 null mutants using group II intron-based insertional mutagenesis or fluorescence-reported allelic exchange mutagenesis (FRAEM) have been unsuccessful despite multiple attempts . This suggests that CT006 may be essential for bacterial survival or that technical challenges prevent successful mutagenesis of this locus.

Researchers facing this challenge should consider alternative approaches:

  • Employing conditional knockdown systems (e.g., CRISPRi) rather than complete knockout

  • Using dominant-negative approaches by overexpressing non-functional CT006 variants

  • Developing more refined gene editing techniques specifically optimized for challenging chlamydial genes

  • Employing chemical genetics approaches using small molecule inhibitors targeted to CT006

How can researchers differentiate between direct and indirect effects of CT006 on lipid droplet interactions?

While cells infected with C. trachomatis overproducing CT006-2HA showed increased lipid droplet area within the inclusion region, this effect could not be directly correlated with the lipid droplet-targeting regions identified in transfection experiments . This discrepancy highlights the challenge of distinguishing direct from indirect effects of CT006 manipulation.

To address this methodological challenge:

  • Develop live-cell imaging approaches to visualize dynamic interactions between CT006, lipid droplets, and inclusions in real-time

  • Employ proximity labeling techniques to identify direct protein-protein or protein-lipid interactions

  • Perform in vitro reconstitution experiments using purified components to test direct interactions

  • Use correlative light and electron microscopy to visualize ultrastructural details of CT006-lipid droplet interactions

What standardized assays can quantitatively assess CT006 function during infection?

The functional assessment of CT006 during infection has relied primarily on measuring inclusion size and infectious progeny production, with limited quantitative analysis of lipid droplet interactions . Developing more robust and standardized assays would facilitate comparative studies across laboratories.

Recommended standardized assays include:

  • Quantitative lipid trafficking assays using fluorescently labeled lipids to measure transport into the inclusion

  • Proteomic analysis of purified inclusions to quantify lipid-associated protein recruitment

  • Lipidomic profiling of isolated C. trachomatis elementary bodies to assess changes in bacterial lipid composition

  • High-content imaging workflows with automated quantification of inclusion-lipid droplet interactions across large cell populations

  • Time-resolved analysis of lipid droplet dynamics throughout the developmental cycle

CT006 Structural Features and Domains

Domain/RegionAmino Acid PositionPredicted FunctionExperimental Evidence
N-terminal region1-88Lipid droplet targeting, exposed to host cytosolGSK-tag phosphorylation, ectopic expression
Hydrophobic domain47-69Unknown, exposed to host cytosolHydropathy analysis, GSK-tag experiments
Bilobed hydrophobic motif89-140Inclusion membrane insertionCharacteristic Inc feature
Transmembrane segment 189-116Membrane anchoringHydropathy analysis
Loop region117-122Connects transmembrane segmentsStructural prediction
Transmembrane segment 2123-140Membrane anchoringHydropathy analysis
C-terminal region141-189Exposed to host cytosolGSK-tag phosphorylation

Experimental CT006 Variants and Their Properties

CT006 VariantModificationLocalization in Transfected CellsEffect on Inclusion SizeEffect on Progeny
CT006-FLFull-length proteinER and lipid droplet associationNot testedNot tested
CT006 1-88N-terminal fragmentStrong lipid droplet associationNot testedNot tested
CT006 139-189C-terminal fragmentCytosolic distributionNot testedNot tested
CT006-2HA2HA tag at C-terminusInclusion membraneNo significant changeNo significant change
CT006 5G-2HAPositive charges mutated to glycineInclusion membraneSignificantly largerNo significant change
CT006 Δ47-67-2HADeletion of hydrophobic domainInclusion membraneSignificantly smallerNo significant change

Timeline of CT006 Localization During Infection

Time Post-InfectionCT006 LocalizationExperimental Evidence
2 hoursDelivered into host cellsImmunofluorescence microscopy
8 hoursSmall tubules near inclusionImmunofluorescence microscopy
16-24 hoursAccumulation at inclusion membraneImmunoblotting and immunofluorescence
24-44 hoursContinuous presence at inclusion membraneImmunoblotting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.