Recombinant Chlamydia trachomatis Uncharacterized protein CT_036 (CT_036)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
CT_036; Uncharacterized protein CT_036
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
CT_036
Target Protein Sequence
MFPIECHTLQTSFKQVLSLVAEKITTKAFVIFSVLFSLIIGFIASCGFLFAGPPAFIASG LCFALLVSVVSFFGCQKLIPYGIQHLMSYVKSIPSLSSSLIDFLKTESKSISSLYPNPGL KECFKGASPKYKKFFFDHPEKLLSAAFTDWTPQIIPSDSGQPRTIILSHSSLPFSLTLST LDFETLHTHLIKSNALTCRVGYAHQLPSGNPVMREAKEGVLQQHYDTGNETFFISIQESK QLQQEELFKKLFSHYAQITEHNLSNEILLLEPLKTPLHTPKARTLELLALFCALEQLRYT KVADWRTKKLAPIFPLDYEDFFTLFMKKQHYTLPGNVSNMRILSPVRPVSETALTTIIIS GLEEEDKLGLLGQVQPFLFDAEEAHPQRGESILIQNVLDDITQ
Uniprot No.

Target Background

Database Links

KEGG: ctr:CT_036

Protein Families
Chlamydial CPn_0129/CT_036/TC_0306 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of CT_036 protein?

Recombinant Chlamydia trachomatis Uncharacterized Protein CT_036 is a bacterially derived protein fragment corresponding to residues 1-403 of the full-length CT_036 protein from C. trachomatis strain D/UW-3/Cx. The protein is classified among chlamydial proteins that have been studied in the context of inclusion membrane (Inc) proteins, though its precise subcellular localization remains inconsistent across different strains.

The protein's structure shows partial homology to other Inc proteins, which suggests potential interaction capabilities with both bacterial components and host factors. When studying CT_036, researchers typically work with recombinant versions that can be expressed in bacterial systems, allowing for purification and subsequent structural or functional analyses.

For experimental work, it's important to note that the recombinant protein should be stored properly, as repeated freezing and thawing is not recommended for maintaining structural integrity.

How does CT_036 localization vary across different C. trachomatis strains?

Studies comparing CT_036 across different C. trachomatis strains have revealed significant inconsistencies in subcellular localization. These variations are summarized in the table below:

StrainCT_036 OrthologLocalization StatusProposed Localization
L2/434/Bu (CTL0291)Truncated (N-terminal)UnclearUndefined
A/HAR-13 (CTA0038)Frameshift MutationNot determinedUndefined
D/UW-3/Cx (CT_036)Full proteinBacteria / UndefinedNot definitively localized to inclusion membrane

In strain D/UW-3/Cx, CT_036 is not definitively localized to the inclusion membrane, unlike other confirmed Inc proteins such as CT005 or CT442. This variability across strains presents a significant challenge for researchers attempting to characterize the protein's function, as localization often provides important clues about a protein's role in bacterial pathogenesis.

When designing experiments to study CT_036 localization, immunofluorescence microscopy with strain-specific antibodies is recommended to accurately determine subcellular distribution patterns.

What experimental approaches are recommended for studying CT_036 function?

When investigating the function of uncharacterized proteins like CT_036, a multi-disciplinary approach is recommended:

  • Comparative Genomics: Analyze sequence conservation across Chlamydia species and strains to identify conserved domains and potential functional motifs.

  • Protein Interaction Studies: Employ techniques such as pull-down assays, yeast two-hybrid screens, or proximity labeling methods to identify potential interaction partners.

  • Gene Expression Analysis: Use RNA-Seq or qPCR to determine when CT_036 is expressed during the chlamydial developmental cycle.

  • Localization Studies: Utilize immunofluorescence microscopy with specific antibodies or fluorescently-tagged protein constructs to determine subcellular localization in different chlamydial strains.

  • Functional Knockout/Knockdown: Where possible, employ CRISPR-Cas9 or RNA interference approaches to reduce or eliminate CT_036 expression and observe phenotypic effects .

For analyzing complex datasets generated from these approaches, researchers should consider implementing bioinformatic pipelines similar to those used in other uncharacterized protein studies, which typically include sequence alignment tools, protein structure prediction software, and interaction network analysis platforms.

What are the common challenges in purifying recombinant CT_036 for research use?

Purification of recombinant CT_036 presents several challenges that researchers should anticipate:

  • Solubility Issues: If expressed in E. coli systems, CT_036 may form inclusion bodies due to improper folding, necessitating optimization of expression conditions or use of solubilization buffers.

  • Protein Stability: CT_036 appears to be sensitive to repeated freeze-thaw cycles, requiring careful aliquoting and storage protocols.

  • Conformational Authenticity: Ensuring that the recombinant protein maintains native-like conformation is critical, particularly when studying potential interactions with host factors.

  • Truncation Management: When working with the partial recombinant version (residues 1-403), researchers must consider how the missing C-terminal portion might affect folding and function.

For optimal purification, consider using affinity chromatography with a removable tag system, followed by size exclusion chromatography to ensure protein homogeneity. Expression in specialized bacterial strains designed for membrane or difficult-to-express proteins may improve yields and solubility.

How can we resolve conflicting data regarding CT_036 subcellular localization?

The inconsistent localization data for CT_036 across different C. trachomatis strains presents a complex research challenge. To resolve these conflicts, researchers should consider implementing:

  • Super-resolution Microscopy: Techniques such as STORM or PALM can provide nanometer-scale resolution to precisely determine CT_036 localization relative to the inclusion membrane and other cellular structures.

  • Time-course Studies: Examining localization throughout the developmental cycle may reveal temporal changes in CT_036 distribution that explain conflicting observations.

  • Strain-specific Expression Systems: Developing systems to express the strain-specific variants of CT_036 (including the truncated and frameshift versions) can help determine if genetic differences directly impact localization.

  • Biochemical Fractionation: Combining traditional cell fractionation techniques with quantitative proteomics can provide complementary evidence for protein localization.

  • Validation with Multiple Antibodies: Using multiple antibodies targeting different epitopes of CT_036 can rule out artifactual localization patterns caused by epitope masking or cross-reactivity.

When designing these experiments, researchers should carefully document growth conditions, fixation methods, and developmental stage of C. trachomatis, as these factors may influence protein localization and contribute to the observed inconsistencies across studies.

What methodological approaches can determine if CT_036 is a viable vaccine candidate?

Assessment of CT_036 as a vaccine candidate requires a systematic approach:

  • Immunogenicity Screening: Evaluate the ability of recombinant CT_036 to stimulate both humoral and cell-mediated immune responses in animal models.

  • Epitope Mapping: Identify specific B and T cell epitopes within CT_036 that generate protective immune responses.

  • Cross-reactivity Analysis: Determine if antibodies against CT_036 recognize the protein across different C. trachomatis serovars, which is crucial for broad-spectrum protection.

  • Protection Studies: Conduct challenge experiments in vaccinated animal models to assess protection levels against C. trachomatis infection.

  • Comparative Efficacy: Evaluate CT_036 alongside established vaccine antigens such as MOMP to determine relative efficacy.

  • Formulation Optimization: Test different adjuvants and delivery systems to enhance immune responses to CT_036.

The inconsistent expression of CT_036 across strains presents a significant challenge for vaccine development. Researchers should design constructs that incorporate conserved regions of the protein to maximize cross-serovar protection potential. Additionally, combining CT_036 with other chlamydial antigens in a multi-component vaccine may address strain variability issues.

How can interaction networks be established for an uncharacterized protein like CT_036?

Establishing interaction networks for uncharacterized proteins requires integrated approaches:

  • Proximity-dependent Biotin Identification (BioID): Fuse CT_036 with a biotin ligase to label proximal proteins in living cells, followed by streptavidin pulldown and mass spectrometry.

  • Co-immunoprecipitation coupled with Mass Spectrometry: Use antibodies against CT_036 to pull down protein complexes and identify interactors through LC-MS/MS.

  • Bacterial Two-Hybrid Systems: Adapted for chlamydial proteins, these systems can identify direct protein-protein interactions.

  • Computational Prediction: Use algorithms that predict protein-protein interactions based on sequence homology, co-expression data, and structural features.

  • Validation through FRET or BiFC: Confirm predicted interactions using fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) in cellular contexts.

For data analysis, researchers should employ network visualization tools to construct interaction maps and identify central nodes. The resulting networks should be analyzed in the context of known chlamydial pathways to generate hypotheses about CT_036 function. This approach resembles the strategy used by Morgan et al. in their study of BRWD2/PHIP protein, where they integrated multiple experimental technologies to establish functional connections .

What statistical approaches are most appropriate for analyzing strain-specific variations in CT_036 expression?

When analyzing strain-specific variations in CT_036 expression, researchers should consider:

  • Normalization Strategies: Determine appropriate reference genes for qPCR studies across different chlamydial strains, as standard housekeeping genes may vary in expression.

  • Statistical Tests for Differential Expression:

    • For normally distributed data: ANOVA followed by post-hoc tests for multi-strain comparisons

    • For non-parametric analysis: Kruskal-Wallis test followed by Dunn's test

    • For time-course studies: Mixed-effects models that account for both strain and temporal variations

  • Effect Size Calculation: Report Cohen's d or similar metrics to quantify the magnitude of expression differences between strains.

  • Power Analysis: Conduct a priori power analyses to determine appropriate sample sizes for detecting strain differences with sufficient statistical power.

  • Data Visualization: Use heatmaps, volcano plots, and principal component analysis to visualize complex multi-strain expression patterns.

When implementing these analyses, researchers should follow the structured approach outlined in modern research design guidelines . This includes:

  • Clearly defining research hypotheses before data collection

  • Pre-specifying primary and secondary outcome measures

  • Planning appropriate statistical tests based on data distribution and study design

  • Addressing potential confounding variables

How can researchers design experiments to elucidate the functional significance of CT_036 in chlamydial pathogenesis?

To determine the functional significance of CT_036 in chlamydial pathogenesis, researchers should design comprehensive experiments that address multiple aspects of pathogen-host interaction:

  • Gene Knockout/Knockdown Studies:

    • Implement CRISPR interference or antisense RNA approaches to reduce CT_036 expression

    • Assess the impact on chlamydial growth kinetics, inclusion formation, and host cell response

    • Measure bacterial replication efficiency in various cell types with modified CT_036 expression

  • Host Response Analysis:

    • Compare host transcriptomic and proteomic profiles in response to wild-type versus CT_036-deficient strains

    • Assess changes in inflammatory signaling pathways, cytokine production, and cell death mechanisms

    • Evaluate differences in host immune recognition patterns

  • In vivo Infection Models:

    • Develop animal models infected with wild-type versus CT_036-modified strains

    • Monitor disease progression, bacterial shedding, and tissue pathology

    • Assess differences in immune cell recruitment and activation

  • Complementation Studies:

    • Reintroduce wild-type or mutated versions of CT_036 into deficient strains

    • Determine which domains or residues are critical for protein function

    • Assess restoration of wild-type phenotypes

Following the principles of experimental design outlined in research methodology literature , researchers should implement controlled comparison groups, appropriate randomization, and blinding procedures where possible. When analyzing complex datasets from these experiments, statistical approaches similar to those used in clinical trials research may be adapted, including multiple comparison corrections and sensitivity analyses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.