Recombinant Chlamydia trachomatis Uncharacterized protein CT_474 (CT_474)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CT_474; Uncharacterized protein CT_474
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
CT_474
Target Protein Sequence
MGIEGRGSGAMQSKKTIKWLKQALVLSSIVNILLLLLIYSTVFRKDIYKLRVFPGNLIAK SSRIGKIPEDILERLENASFADLLALLQEERMVFGHPLKSWALGVSIQKYFVDIAPMLTH PLTFIRLKSPERTWLLPDINDQEFTRICQYLLTERFPFSSRGFFRIMVRDCEAGMVDEDV LYRFCHLPEFLYVRSLLFGAEIEAASVASLARMIIQGGEDLFFSLCCLENRQTAISDHQR RCFLKAYVDRQEPLAALLLLVHDADWVLHEFSDSDLQSFIQLLPREAHYTKKFLGCVAQS CRLGILLEG
Uniprot No.

Target Background

Database Links

KEGG: ctr:CT_474

Protein Families
Chlamydial CPn_0593/CT_474/TC_0759 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How can recombinant CT_474 be effectively expressed and purified?

Recombinant expression of CT_474 can be achieved using E. coli as an expression system. The methodological approach includes:

  • Cloning the full-length gene (1-309 aa) into an appropriate expression vector with an N-terminal His-tag

  • Transforming the construct into a compatible E. coli strain (such as BL21(DE3))

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying using nickel affinity chromatography

  • Further purification using size exclusion chromatography if higher purity is required

The expressed protein is typically obtained as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE. For optimal results, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability .

What are the optimal storage conditions for recombinant CT_474?

For maximum stability and retained activity of recombinant CT_474, implement the following storage protocol:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50%

  • Prepare multiple small aliquots to avoid repeated freeze-thaw cycles

  • For short-term usage (up to one week), working aliquots can be stored at 4°C

  • For long-term storage, maintain at -20°C to -80°C

  • Briefly centrifuge vials prior to opening to ensure all content is at the bottom

  • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 as a storage buffer

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity .

What methods can be used to determine if CT_474 is secreted via the Chlamydia Type III Secretion System (cT3SS)?

Determining CT_474 secretion via the cT3SS requires a multi-faceted approach:

  • Surrogate System Validation: Clone CT_474 into vectors like pBomb4 CyaA, pBomb4 BlaM, or pBomb4 GSK-FLAG for expression in surrogate organisms such as Yersinia pseudotuberculosis, Shigella flexneri, or Salmonella enterica. Monitor secretion using reporter assays specific to each system .

  • Native Validation: Express epitope-tagged CT_474 in C. trachomatis using transformation with stably maintained plasmids (e.g., pBomb4-tet-mCherry with a FLAG-tag). Add anhydrotetracycline (aTc) at ~10 ng/ml at the time of infection to induce expression .

  • Detection Methods:

    • Immunofluorescence microscopy: Fix cells with 4% formaldehyde 24h post-infection and stain with DAPI, anti-FLAG, and anti-C. trachomatis antibodies

    • Western blotting: Separate host cytosolic fractions from bacterial fractions

    • Mass spectrometry: Perform affinity purification-mass spectrometry (AP-MS) to identify secreted proteins

It's important to note that validation in surrogate systems does not necessarily correlate with secretion in the native organism, necessitating direct validation in C. trachomatis .

How might CT_474 compare to known inclusion membrane proteins (Incs) in C. trachomatis?

When analyzing CT_474 in relation to characterized inclusion membrane proteins:

  • Structural Comparison: Examine CT_474's sequence for the characteristic bilobed hydrophobic domain common to Inc proteins. Unlike confirmed Inc proteins such as CT006, CT_474 may lack this distinctive feature or contain variations of it .

  • Localization Studies: Perform immunofluorescence microscopy with tagged CT_474 to determine if it localizes to the inclusion membrane, similar to the 22 experimentally confirmed Inc proteins out of the 50 predicted Inc proteins in C. trachomatis .

  • Host Interaction Assessment: Use techniques such as:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Ectopic expression in yeast and mammalian cells to identify potential organelle tropism

  • Functional Analysis: Assess if CT_474, when ectopically expressed, affects subsequent chlamydial infection or co-localizes with host cell structures such as the endoplasmic reticulum, similar to studies performed with other Inc proteins .

Experimental evidence suggests that inclusion membrane-localized proteins are often immunogenic during C. trachomatis infection in humans, particularly regions exposed to the host cytoplasm. Testing patient sera against CT_474 could provide insights into its potential role during infection .

What experimental approaches can be used to determine the function of CT_474 during C. trachomatis infection?

Elucidating the function of an uncharacterized protein like CT_474 requires multiple complementary approaches:

  • Interactome Analysis: Perform affinity purification-mass spectrometry (AP-MS) using FLAG-tagged CT_474 expressed in C. trachomatis to identify high-confidence interacting partners. This approach has successfully identified host pathways targeted by other cT3SS effector proteins .

  • Domain Mapping: Create truncation constructs of CT_474 to determine which regions are responsible for specific interactions or localizations, similar to the approach used with CT006 to identify lipid droplet-targeting regions .

  • Host Cell Impact Assessment:

    • Examine changes in host cell processes when CT_474 is overexpressed

    • Monitor alterations in inclusion morphology, size, or composition

    • Assess effects on bacterial replication and development

  • Comparative Genomics: Analyze conservation of CT_474 across Chlamydia species and strains to infer functional importance based on evolutionary conservation.

  • Molecular Genetics: If possible, generate C. trachomatis strains overproducing CT_474 with epitope tags, and compare phenotypes with wild-type strains to identify potential functional roles .

What controls should be included when studying CT_474 localization during infection?

When designing experiments to study CT_474 localization, implement the following controls:

Control TypeDescriptionPurpose
Negative Vector ControlC. trachomatis expressing FLAG-tagged empty vectorEstablishes baseline for non-specific staining
Positive Inc ControlC. trachomatis expressing known Inc protein (e.g., TmeA-FLAG)Confirms proper inclusion membrane staining pattern
Non-Inc Bacterial ControlC. trachomatis expressing known non-Inc proteinDifferentiates inclusion membrane vs bacterial cytoplasmic localization
Timing ControlsSamples fixed at multiple time points post-infection (e.g., 8h, 16h, 24h, 48h)Determines temporal expression and localization patterns
Antibody ControlsSecondary antibody only, isotype controlsEnsures specificity of immunostaining

Additionally, use multiple detection methods including immunofluorescence microscopy, subcellular fractionation, and biochemical approaches to conclusively determine localization .

How can researchers address the challenge of studying proteins from genetically intractable organisms like C. trachomatis?

Working with genetically challenging organisms like C. trachomatis requires creative experimental approaches:

  • Heterologous Expression Systems:

    • Express CT_474 in Saccharomyces cerevisiae to screen for functional effects such as vacuolar protein sorting defects

    • Use mammalian cell expression systems to identify potential organelle tropism and host targets

    • Employ surrogate bacterial systems (Yersinia, Shigella, Salmonella) for secretion studies

  • Advanced Genetic Techniques:

    • Leverage cutting-edge chlamydial genetic tools, including transformation with stably maintained plasmids

    • Use inducible expression systems with anhydrotetracycline (aTc) control

    • Apply multiple reporter constructs to validate protein expression and secretion

  • Biochemical Approaches:

    • Perform in vitro functional assays with purified recombinant CT_474

    • Use chemical crosslinking to capture transient protein-protein interactions

    • Apply structural biology techniques (X-ray crystallography, cryo-EM) to gain functional insights

When using surrogate systems, researchers must validate findings in the native organism whenever possible, as secretion in surrogate systems does not necessarily correlate with secretion in C. trachomatis .

What are the key considerations for designing antibodies against CT_474?

Development of effective antibodies against CT_474 requires strategic planning:

  • Epitope Selection:

    • Analyze the CT_474 sequence for hydrophilic, surface-exposed regions likely to be immunogenic

    • Consider targeting regions predicted to be exposed to the host cytoplasm if CT_474 is membrane-associated

    • Avoid hydrophobic regions that may be embedded in membranes and inaccessible to antibodies

  • Antibody Format Options:

    • Polyclonal antibodies: Provide broader epitope recognition but potential for cross-reactivity

    • Monoclonal antibodies: Offer high specificity but may be limited by single epitope recognition

    • Epitope tag-based detection: Useful for recombinant studies but requires genetic manipulation

  • Validation Strategies:

    • Western blot against purified recombinant CT_474

    • Immunofluorescence microscopy using both transfected and infected cells

    • Pre-absorption controls to confirm specificity

    • Testing multiple independent antibodies targeting different epitopes

Human sera from patients with C. trachomatis infections can provide valuable insights, as antibodies from these individuals preferentially recognize proteins localized in the inclusion membrane, particularly regions exposed to the cytoplasm .

How might understanding CT_474 contribute to broader knowledge of C. trachomatis pathogenesis?

Characterizing CT_474 has several potential implications for understanding C. trachomatis pathogenesis:

  • Host-Pathogen Interface Insights: If CT_474 is confirmed as a secreted effector or inclusion membrane protein, it could represent another component of the complex host-pathogen interface established during infection.

  • Novel Functional Pathways: As an uncharacterized protein, CT_474 may reveal previously unknown mechanisms by which C. trachomatis manipulates host cell processes. The complete mapping of secreted effectors and their targets is revealing extensive manipulation of host pathways .

  • Evolutionary Context: Comparative analysis of CT_474 across Chlamydia species could illuminate evolutionary adaptations specific to human infection versus animal infections.

  • Therapeutic Target Potential: Understanding CT_474's role may identify vulnerability points that could be exploited for therapeutic intervention, particularly if it plays a crucial role in bacterial replication or persistence.

The comprehensive characterization of chlamydial effector proteins has already begun revealing sophisticated mechanisms of host manipulation. Adding CT_474 to this understanding would further complete the picture of chlamydial pathogenesis .

What approaches can be used to determine if CT_474 interacts with host cell lipid droplets similar to CT006?

To investigate potential interactions between CT_474 and host cell lipid droplets:

  • Ectopic Expression Studies:

    • Express full-length CT_474 and various fragments in eukaryotic cells

    • Use fluorescent microscopy to assess colocalization with lipid droplets stained with specific markers (e.g., BODIPY or LipidTOX)

    • Create truncation constructs to map any potential lipid droplet-targeting regions

  • Infection Studies:

    • Generate a C. trachomatis strain overproducing tagged CT_474

    • Compare lipid droplet distribution and area within inclusions between this strain and wild-type

    • Quantify lipid droplet recruitment to the inclusion using automated image analysis

  • Molecular Interaction Analysis:

    • Identify potential amphipathic helices or hydrophobic regions that might mediate lipid droplet association

    • Perform site-directed mutagenesis of positively charged residues, which have been important for lipid droplet targeting in other proteins like CT006

    • Use proximity labeling techniques (BioID, APEX) to identify molecular neighbors of CT_474 during infection

The identification of CT006 as a lipid droplet-associated protein provides a valuable experimental framework and positive control for these studies .

What are the most pressing unanswered questions about CT_474?

The critical knowledge gaps regarding CT_474 include:

  • Localization: Whether CT_474 is secreted via the cT3SS and where it localizes during infection (inclusion membrane, bacterial cytoplasm, or host cytoplasm)

  • Function: The molecular and cellular functions of CT_474 during the C. trachomatis lifecycle

  • Host Targets: Identification of host cellular components and pathways that may be manipulated by CT_474

  • Structural Features: Detailed three-dimensional structure and how it relates to function

  • Conservation: Whether CT_474 is conserved across Chlamydia species and strains, suggesting functional importance

Addressing these questions will require integration of multiple experimental approaches and potentially the development of new methodologies for studying difficult-to-manipulate bacterial pathogens like C. trachomatis .

How can researchers best navigate the technical challenges of working with CT_474?

The technical challenges of working with CT_474 can be addressed through:

  • Reagent Optimization:

    • Carefully calibrate expression conditions to maximize soluble protein yield

    • Test multiple purification strategies to obtain high-quality protein

    • Store recombinant protein appropriately to maintain activity

  • Multidisciplinary Approaches:

    • Combine bioinformatics prediction, biochemical characterization, and cellular localization studies

    • Utilize both surrogate systems and native expression when possible

    • Collaborate across specialties (structural biology, cell biology, microbiology)

  • Technical Innovations:

    • Apply cutting-edge chlamydial genetics tools

    • Utilize advanced microscopy techniques for live-cell imaging

    • Employ systems biology approaches to place CT_474 in broader context

  • Validation Strategies:

    • Confirm findings using multiple independent methods

    • Verify that observations in surrogate systems correlate with the native context

    • Use appropriate controls at all experimental stages

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.