Recombinant Chlamydia trachomatis UPF0056 membrane protein CT_852 (CT_852)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Please note: The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that specific tag.
Synonyms
CT_852; UPF0056 membrane protein CT_852
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
CT_852
Target Protein Sequence
MLHSLFRLTLLFYALFNALGSLPVFIALLKNFSFKKQQHIILRESIFALLLLLLFVTFGR GFFRLLGIILPAFQFTGSLLLGSIAIDMMKALPPQTETLERDKDEPIFFPLAFPVITGPA MITSTLGHMEEGIFPKKIVLGAIVLAWLFSLITLLLSSSINRLFGQMGLLALERLFGISL ALMAGNLMLKALSTAFNIGYYVTP
Uniprot No.

Target Background

Database Links

KEGG: ctr:CT_852

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CT_852 and why is it significant in C. trachomatis research?

CT_852 is an uncharacterized protein family (UPF0056) membrane protein encoded by the CT_852 gene in the Chlamydia trachomatis genome. Its significance stems from its potential role in C. trachomatis pathogenesis and membrane structure. Similar to other C. trachomatis membrane proteins, CT_852 may be involved in host-pathogen interactions during infection. C. trachomatis is an obligate intracellular bacterial parasite that causes several severe diseases in humans, including sexually transmitted infections that affect more than 100 million people annually . Understanding membrane proteins like CT_852 is crucial because they often play key roles in bacterial survival, replication within host cells, and interaction with host cell components .

How does CT_852 compare structurally to other characterized C. trachomatis membrane proteins?

While CT_852 remains relatively uncharacterized compared to proteins like MOMP (Major Outer Membrane Protein) or inclusion membrane proteins (Incs), it likely shares some structural features with other bacterial membrane proteins. Unlike the well-studied MOMP, which forms a β-barrel structure , or Inc proteins that typically contain bi-lobed hydrophobic domains that anchor them in the inclusion membrane , CT_852's exact structure requires experimental determination.

Structural analysis methods would include:

  • Sequence-based prediction of transmembrane domains and topology

  • Circular dichroism spectroscopy to determine secondary structure elements

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

  • Comparative modeling based on homologous proteins from other bacteria

Unlike CT006, which has been shown to have regions exposed to the host cell cytosol , the membrane topology of CT_852 would need to be experimentally verified to determine which domains might interact with host cell components.

What expression systems are most effective for producing recombinant CT_852?

Based on experience with similar C. trachomatis membrane proteins, the following expression systems could be considered:

Expression SystemAdvantagesDisadvantagesPurification Method
E. coli (BL21)High yield, cost-effectivePotential misfolding of membrane proteinsIMAC with detergent solubilization
Insect cells (Sf9, High5)Better folding of complex proteinsMore expensive, lower yieldAffinity chromatography
Cell-free systemsAvoids toxicity issuesLower yield, expensiveDirect capture from reaction mixture
Mammalian cells (HEK293)Native-like post-translational modificationsHighest cost, complex protocolsAffinity purification

When expressing recombinant CT_852, it's crucial to maintain its native conformation. Similar to the approaches used for CTH522 (a MOMP-based recombinant antigen), CT_852 might require careful optimization of expression conditions to preserve structural integrity . For membrane proteins, detergent screening is essential during purification to identify conditions that maintain the protein in a stable, folded state.

What are the optimal methods for studying CT_852 localization during C. trachomatis infection?

To study CT_852 localization during infection, researchers should consider a multi-faceted approach:

  • Generate specific antibodies against CT_852 or create tagged versions (e.g., HA-tag, similar to approaches used for CT006 )

  • Perform immunofluorescence microscopy of infected cells fixed at different time points

  • Use co-localization studies with markers for specific cellular compartments

  • Employ super-resolution microscopy techniques (STORM, STED) for precise localization

  • Complement imaging with biochemical fractionation of infected cells

When designing these experiments, controls are critical. For example, when studying CT006, researchers confirmed protein topology by showing that both N- and C-terminal regions were exposed to the host cell cytosol . Similar approaches should be used for CT_852.

How can researchers effectively design mutagenesis studies to identify functional domains within CT_852?

Systematic mutagenesis approaches for CT_852 functional studies should include:

Mutagenesis ApproachTarget SelectionReadoutAnalysis Method
Alanine scanningConserved residuesProtein localization, bacterial growthImmunofluorescence, growth curves
Domain deletionPredicted functional regionsProtein-protein interactionsCo-immunoprecipitation, Y2H
Site-directed mutagenesisCharged residues (as in CT006 )Membrane associationFractionation studies
Chimeric constructsDomain swapping with homologsFunction complementationFunctional assays

When designing these experiments, researchers should first perform bioinformatic analyses to identify conserved regions and predicted functional domains. For instance, when studying CT006, researchers identified a lipid droplet-targeting region within the first 88 amino acid residues and determined that positively charged residues were important for this targeting . A similar methodical approach would be valuable for CT_852.

What controls are essential when performing interaction studies between CT_852 and host cell components?

When investigating potential interactions between CT_852 and host components, the following controls are essential:

  • Negative controls: Unrelated bacterial membrane proteins of similar size and topology

  • Positive controls: Known interacting proteins from C. trachomatis

  • Truncation controls: Separate domains of CT_852 to identify specific interaction regions

  • Competitive binding assays: To confirm specificity of interactions

  • Reciprocal co-immunoprecipitation: To validate interactions from both protein perspectives

For example, when studying CT006's association with lipid droplets, researchers performed systematic analyses using different protein fragments expressed in yeast and mammalian cells to identify specific targeting regions . This methodical approach ensured that the observed interactions were specific and physiologically relevant.

How should researchers analyze evolutionary conservation patterns of CT_852 across Chlamydia species?

To analyze evolutionary conservation of CT_852, researchers should:

  • Collect homologous sequences from different Chlamydia species and strains

  • Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL

  • Calculate conservation scores for each residue

  • Identify regions under positive or purifying selection

  • Generate a phylogenetic tree to visualize evolutionary relationships

Analysis of recombination and selection is particularly important. As demonstrated in C. trachomatis genome studies, both recombination and positive selection can significantly impact genetic diversification . The ratio of recombination events compared to mutation (ρ/θ) was found to be 0.07 in C. trachomatis, but recombination had a significant effect on genetic diversification (r/m = 0.71) . When analyzing CT_852, researchers should determine whether it falls into the category of genes that show evidence of both positive selection and recombination, similar to genes with known roles in virulence and pathogenicity (e.g., ompA, pmps, tarp) .

What statistical approaches are most appropriate for analyzing CT_852 structural data?

For structural data analysis, researchers should consider:

Data TypeStatistical ApproachOutput FormatInterpretation Guidelines
Secondary structure predictionConsensus methods combining multiple algorithmsPercentage of α-helix, β-sheet, random coilCompare to known membrane proteins
Hydrophobicity analysisSliding window analysis with multiple scalesHydropathy plotsIdentify potential transmembrane regions
Evolutionary conservation mappingPosition-specific scoring matricesHeat maps on structural modelsIdentify functional surfaces
Molecular dynamics simulationsPrincipal component analysisEnergy landscapesAnalyze conformational flexibility

When reporting structural data, researchers should follow proper data presentation guidelines. Tables should have clear titles relating to the data presented, appropriately labeled columns including units, and consistent precision in numerical values . All statistical analyses should include appropriate measures of uncertainty and significance.

How can researchers effectively compare and contrast the functional significance of CT_852 with other membrane proteins in C. trachomatis?

To compare CT_852 with other membrane proteins:

  • Perform functional clustering based on expression patterns during the infection cycle

  • Conduct comparative interaction studies to identify shared or unique host binding partners

  • Analyze the effect of gene knockouts/knockdowns on bacterial fitness and host response

  • Compare subcellular localization patterns throughout infection

  • Systematically analyze posttranslational modifications across different membrane proteins

When comparing membrane proteins, researchers could create comparative tables similar to those used for analyzing recombination patterns in C. trachomatis . These should include criteria such as cellular localization, interacting partners, effect on host cell processes, and contribution to bacterial virulence.

What are the current challenges in developing antibodies or other detection reagents specific to CT_852?

Developing specific detection reagents for CT_852 presents several challenges:

  • Membrane proteins often have limited exposed epitopes

  • High conservation with homologs can reduce specificity

  • Conformational epitopes may be lost during sample processing

  • Low expression levels might limit detection sensitivity

To overcome these challenges, researchers should:

  • Generate antibodies against multiple regions of the protein

  • Consider using recombinant antibody technologies (phage display, yeast display)

  • Validate antibody specificity using knockout strains or heterologous expression systems

  • Develop complementary detection methods like aptamers or nanobodies

For membrane proteins like CT_852, the approach taken for CTH522 (a recombinant MOMP-based antigen) could be informative. Researchers should carefully consider the native structure and ensure that detection reagents recognize physiologically relevant conformations .

How can researchers effectively investigate potential self-assembly properties of CT_852?

Based on findings with other C. trachomatis proteins, CT_852 might exhibit interesting self-assembly properties. For example, the recombinant CTH522 antigen showed unusual self-assembly into nanoparticles with a negative zeta potential, rather than existing as a monomer . To investigate potential self-assembly of CT_852:

  • Perform size exclusion chromatography under various conditions

  • Use dynamic light scattering to measure particle size distributions

  • Employ analytical ultracentrifugation to determine oligomeric states

  • Visualize assemblies using electron microscopy

  • Analyze stability using thermal and chemical denaturation studies

Similar to CTH522, which forms structures stabilized by denaturant-disruptable hydrophobic interactions , CT_852 might form supramolecular assemblies with unique structural properties. Careful biophysical characterization will be essential to understand these properties.

What methodological approaches are most effective for studying the role of CT_852 in C. trachomatis pathogenesis?

To investigate CT_852's role in pathogenesis:

ApproachMethod DetailsExpected OutcomesLimitations
Genetic manipulationConditional knockdown, CRISPR interferencePhenotypic changes in growth or virulenceTechnical difficulty in obligate intracellular pathogen
Heterologous expressionExpression in related bacteria or yeastIdentification of protein functionMay not replicate native environment
Infection modelsCell culture and animal models with modified strainsIn vivo relevance of phenotypesEthical considerations, model limitations
Systems biologyTranscriptomics, proteomics integrationNetwork-level understandingComputational complexity, validation requirements

When designing these studies, it's important to consider the obligate intracellular nature of C. trachomatis. As demonstrated in studies of CT006, overexpression approaches can be valuable when direct knockout is challenging . Researchers generated a C. trachomatis strain overproducing CT006 with a double hemagglutinin tag and observed effects on lipid droplets within the inclusion region . Similar approaches could be applied to CT_852.

How might advances in cryo-electron microscopy impact structural studies of CT_852?

Recent advances in cryo-electron microscopy (cryo-EM) have revolutionized structural biology of membrane proteins. For CT_852 research:

  • Single-particle cryo-EM could resolve the structure of CT_852 in detergent micelles or nanodiscs

  • Cryo-electron tomography could visualize CT_852 in situ within bacterial membranes or inclusion membranes

  • Time-resolved cryo-EM might capture dynamic structural changes during host interaction

  • Correlative light and electron microscopy could connect functional data with structural insights

These methods overcome limitations of traditional crystallography, which has historically been challenging for membrane proteins. With continued improvements in resolution and sample preparation, cryo-EM could reveal critical structural features of CT_852 that inform its function in C. trachomatis pathogenesis.

What are the most promising approaches for investigating potential CT_852 interaction with host immune components?

To investigate CT_852's potential role in immune modulation:

  • Perform systematic screening against pattern recognition receptors

  • Test effects on inflammatory signaling pathways in relevant cell types

  • Investigate antigen presentation of CT_852-derived peptides

  • Examine antibody responses to CT_852 in natural infection

  • Evaluate effects on immune cell recruitment and activation

Understanding these interactions is crucial as C. trachomatis effectively evades host immune responses to establish persistent infection. Comparative studies with other membrane proteins would help determine whether CT_852 plays a unique role in immune modulation or shares functions with other C. trachomatis membrane proteins.

How can computational approaches enhance our understanding of CT_852 function in the context of the complete C. trachomatis proteome?

Computational methods to investigate CT_852 in systems context include:

  • Protein-protein interaction network prediction and validation

  • Gene co-expression analysis across infection time course

  • Evolutionary rate covariation to identify functionally related proteins

  • Molecular dynamics simulations of CT_852 in membrane environments

  • Machine learning approaches to predict functional partners

These computational approaches should be integrated with experimental data. For instance, genomic analyses of C. trachomatis identified 836 core genes out of 874-927 total genes in each genome . Understanding where CT_852 fits within this core genome and whether it shows evidence of recombination or positive selection (as was found for 23 genes in C. trachomatis ) would provide valuable context for functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.