Recombinant Chlamydia trachomatis UPF0092 membrane protein CT_741 (CT_741)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requirements for the format. Please specify your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form maintains a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yajC; CT_741; Sec translocon accessory complex subunit YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Chlamydia trachomatis (strain D/UW-3/Cx)
Target Names
yajC
Target Protein Sequence
MYSRLFFSILFFLGCCPALFADTDSPQRATFGQPAVMLGIAIVFFYFILWRPEQKRRQAM EKRKSELAVGDKVTAMGIVGTIAEIREHTVILNIASGKIEILKAAISEILKAEK
Uniprot No.

Target Background

Function
The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, insertion of proteins into membranes, and the assembly of membrane protein complexes. While the SecYEG complex plays a crucial role in the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these functions.
Database Links

KEGG: ctr:CT_741

Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What are the major challenges in expressing recombinant Chlamydia trachomatis membrane proteins?

Recombinant expression of Chlamydia trachomatis membrane proteins presents several significant challenges. The primary difficulty stems from proper protein folding and localization when expressed in heterologous systems. When expressed in E. coli cytoplasm, proteins like MOMP typically form inclusion bodies, resulting in improperly folded structures with reduced immunogenicity and functionality compared to native proteins . This misfolding problem is particularly evident when comparing the efficacy of recombinant MOMP extracted from inclusion bodies to native MOMP in mouse challenge models, where the recombinant version shows reduced protection .

Additionally, membrane proteins from eukaryotic organisms cannot be reliably produced in sufficient quantities for structural analysis, making them recognized as primary bottlenecks in structural genomics programs . The complex structure of membrane proteins, especially those containing β-barrel integral outer membrane arrangements like MOMP, requires careful consideration of expression conditions to maintain functional conformations.

What expression systems have proven most effective for Chlamydia membrane proteins?

E. coli remains the predominant expression system for Chlamydia membrane proteins, with targeted expression to the outer membrane showing superior results over cytoplasmic expression. Successful surface expression in E. coli requires several optimization strategies:

  • Codon harmonization to match the expression host

  • Utilization of low copy number vectors

  • Selection of promoters with moderate strength

  • Implementation of suitable leader sequences

  • Careful optimization of cell culture conditions

For researchers working with CT_741 or similar membrane proteins, this targeted outer membrane expression approach has demonstrated significant advantages over traditional cytoplasmic expression. The E. coli system allows for extraction of membrane proteins in their native conformation, which is crucial for maintaining proper structure and function.

Yeast expression systems present an alternative, though culture conditions must be tightly controlled. When using yeast, optimal production requires:

  • Moderate rather than rapid growth conditions

  • Precise harvest timing prior to glucose exhaustion

  • Collection just before the diauxic shift

The selection between these systems should be guided by the specific properties of the target protein and the intended downstream applications.

How should purification protocols be optimized for Chlamydia membrane proteins?

Purification protocols must be carefully designed to maintain the conformational integrity of Chlamydia membrane proteins. This is especially critical as denaturation significantly reduces the protective efficacy of membrane proteins in vaccine studies . A systematic approach includes:

  • Gentle extraction from the bacterial membrane using mild detergents that preserve protein-protein interactions and tertiary structure

  • Biophysical characterization at each purification step to monitor structural integrity

  • Avoidance of harsh conditions that may disrupt conformational epitopes

For CT_741 and similar proteins, conformational integrity is particularly important when the recombinant proteins are intended for immunological studies or vaccine development. Studies comparing denatured (boiled) and non-denatured Chlamydial outer membrane complex (COMC) preparations demonstrated that denaturation significantly reduced protection against genital infection and pathology .

What growth conditions maximize membrane protein yield and quality?

Contrary to conventional wisdom, the most rapid growth conditions are not optimal for membrane protein production. Research has demonstrated that:

  • Moderate growth conditions often yield better results than maximum growth rate conditions

  • The growth phase at which cells are harvested is critical

  • Cells should be grown under tightly controlled conditions

  • Harvesting should occur prior to glucose exhaustion, just before the diauxic shift

These findings suggest that the cellular physiology and metabolic state play crucial roles in proper membrane protein expression and folding. The differences in membrane protein yields under various culture conditions are not reflected in corresponding mRNA levels but rather relate to differential expression of genes involved in protein secretion and cellular physiology .

For high-yield production, bioreactors with tightly defined growth regimes provide superior control compared to shake flask cultures, allowing for systematic optimization of temperature, pH, dissolved oxygen, and nutrient availability.

How does targeting expression to different cellular compartments affect protein quality?

The subcellular localization of recombinant membrane protein expression significantly impacts protein quality and functionality. Comparing cytoplasmic versus outer membrane-targeted expression of MOMP reveals substantial differences:

Expression LocationAdvantagesDisadvantagesImpact on Functionality
Cytoplasm (Inclusion Bodies)Higher yield, Simpler extractionRequires refolding, Loss of conformational epitopesReduced immunogenicity, Lower protection in challenge models
Outer MembraneNative-like conformation, Preserved epitopesLower yield, More complex extractionHigher immunogenicity, Stronger antibody responses to native antigen

Research demonstrates that MOMP targeted to the E. coli outer membrane elicits antibodies that react effectively to the native Chlamydia elementary body (EB) in mouse immunogenicity models . This approach preserves the β-barrel structure crucial for proper antigen presentation and immunological recognition.

What role does codon optimization play in recombinant membrane protein expression?

Codon optimization strategies significantly impact membrane protein expression levels and quality. For Chlamydia membrane proteins, codon harmonization rather than simple optimization has proven effective . This approach:

  • Adjusts codon usage to match that of the expression host while maintaining the translational rhythm of the native organism

  • Facilitates proper co-translational folding by preserving the natural pauses in protein synthesis

  • Enhances the likelihood of correct membrane integration and tertiary structure formation

When combined with other optimization strategies such as low copy number vectors and promoters with moderate strength, codon harmonization contributes to successful outer membrane expression of complex proteins like MOMP .

How can conformational integrity be assessed for recombinant membrane proteins?

Assessing conformational integrity of recombinant membrane proteins requires multiple complementary approaches:

  • Functional assays: For CT_741 and similar proteins, measuring the ability to elicit antibodies that recognize native antigens provides a functional assessment of proper conformation

  • Biophysical characterization: Techniques including circular dichroism, fluorescence spectroscopy, and thermal stability assays can detect proper secondary and tertiary structure

  • Immunological cross-reactivity: Comparing reactivity of antibodies raised against recombinant versus native protein forms

  • Neutralization capacity: For immunogenic proteins, the ability to generate neutralizing antibodies serves as a functional proxy for proper conformation

Research with Chlamydial outer membrane complex (COMC) demonstrates that conformational integrity is essential for generating broadly reactive immune responses and neutralizing antibodies . When COMC preparations were denatured by boiling, their protective efficacy was significantly reduced, highlighting the critical importance of maintaining native protein conformations .

What statistical approaches are appropriate for optimizing membrane protein production?

Systematic optimization of membrane protein production benefits from structured statistical approaches. Based on clinical trial methodologies, researchers can implement:

  • Modified target probability interval (mTPI) approach: This allows for efficient dose finding in expression optimization studies

  • Accelerated titration design: Beginning with single condition tests followed by expansion based on performance metrics

  • Equivalence interval determination: Establishing acceptable ranges for key parameters rather than single optimal points

When optimizing multiple parameters simultaneously (e.g., temperature, induction timing, media composition), these approaches can be adapted to create efficient experimental designs that identify optimal conditions with fewer experimental iterations.

For example, when determining optimal induction conditions, researchers might start with an accelerated titration approach testing widely spaced conditions, followed by a modified target probability interval approach to narrow down the optimal range.

How do different membrane protein extraction methods compare for structural studies?

Extraction methods significantly impact the structural integrity and functionality of membrane proteins:

Extraction MethodPrinciplesAdvantagesLimitationsApplications
Detergent SolubilizationUses mild detergents to extract proteins from membranesMaintains protein-lipid interactions, Preserves structureDetergent micelles may affect function, Potential incomplete extractionStructural studies, Functional assays
Inclusion Body RecoveryIsolation of aggregated proteins from cytoplasmHigh yield, Simplified purificationRequires refolding, Loss of native structureMass production, Situations where conformation is less critical
Native Extraction (COMC)Extraction of protein-rich outer membrane shellsPreserves protein complexes and interactions, Superior immunogenicityLower yield, More complex processVaccine development, Structural studies of protein complexes

For Chlamydia membrane proteins, the choice of extraction method should be guided by the intended application. Studies show that COMC preparation, which preserves the native protein environment, generates superior immune responses compared to individual recombinant proteins . This suggests that extraction methods preserving the membrane environment and protein-protein interactions offer advantages for immunological and possibly structural studies.

What immunological differences exist between native and recombinant Chlamydia membrane proteins?

Significant immunological differences exist between native and recombinant Chlamydia membrane proteins, with important implications for vaccine development and diagnostic applications:

  • Neutralizing antibody generation: Native or properly folded recombinant membrane proteins generate higher levels of neutralizing antibodies compared to denatured or improperly folded proteins

  • Epitope presentation: Native proteins present conformational epitopes that are often lost in recombinant preparations, particularly those recovered from inclusion bodies

  • Breadth of immune response: The Chlamydial outer membrane complex (COMC) generates broadly reactive immune responses against multiple outer membrane proteins, while individual recombinant proteins elicit narrower responses

  • Protection efficacy: In mouse models, COMC vaccines confer greater protection against genital infection and pathology compared to individual or combinations of recombinant proteins

These differences highlight the importance of proper protein folding and conformation in developing effective immunological tools. For researchers working with CT_741, these findings suggest that approaches preserving the native conformation would likely yield superior results for immunological applications.

What expression and purification strategies are most suitable for UPF0092 family membrane proteins?

Based on the research with other Chlamydia membrane proteins, researchers working with CT_741 should consider:

  • Surface expression targeting rather than cytoplasmic expression to maintain proper folding and conformation

  • Codon harmonization when designing expression constructs

  • Moderate promoter strength and low copy number vectors to prevent overwhelming cellular machinery

  • Careful optimization of leader sequences to ensure proper membrane targeting

  • Growth conditions with moderate rather than maximum growth rates

For purification, gentle extraction methods that preserve the membrane environment initially, followed by careful detergent selection for solubilization, would likely yield superior results compared to denaturing and refolding approaches.

How can functional assays be designed to validate recombinant CT_741?

Functional validation of recombinant CT_741 requires development of specific assays relevant to its biological role. While detailed information about CT_741's function is not provided in the search results, general approaches for membrane protein validation include:

  • Binding assays: If ligands or interaction partners are known, binding affinity and specificity can be measured

  • Structural integrity assessment: Comparing biophysical characteristics to predicted models or related proteins

  • Immunological cross-reactivity: Testing reactivity with antibodies raised against native Chlamydia or whole organism preparations

  • In vivo functionality: Assessment in appropriate model systems if the function is known

The specific assays should be tailored to the known or predicted functions of CT_741, which may include transport, signaling, or structural roles in the bacterial membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.