Recombinant Chlamydomonas moewusii Chlorophyll a-b binding protein of LHCII type I, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein of LHCII type I, chloroplastic; CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-256
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas moewusii (Chlamydomonas eugametos)
Target Protein Sequence
TKQTKAAPAKSAGIEWYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGLSADPETFKK YRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALI HAQNIVATLAVQVVLMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVK EIKNGRLAMFSCFGFFVQAIVTGKGPIQNLADHLADPGTNNAFAAATKFTPSA
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Chlamydomonas moewusii Chlorophyll a-b binding protein of LHCII type I, and what is its biochemical function?

The Chlamydomonas moewusii Chlorophyll a-b binding protein of LHCII type I is a chloroplastic protein that plays a crucial role in the light-harvesting complex II (LHCII) of photosystem II. This protein binds chlorophyll a and b molecules, facilitating efficient light capture during photosynthesis. The mature protein spans amino acids 24-256 and can be produced as a recombinant protein with a His-tag in E. coli expression systems .

In its native context, this protein functions within thylakoid membranes where it contributes to:

  • Light energy absorption across different wavelengths

  • Energy transfer to photosystem reaction centers

  • Structural stabilization of photosynthetic complexes

  • Photoprotection under high light conditions

Research methodologies to study this protein typically involve recombinant expression, purification using affinity chromatography, and spectroscopic analysis to assess pigment binding and energy transfer capabilities.

How do LHCII proteins from different Chlamydomonas species compare in structure and function?

LHCII proteins across Chlamydomonas species (including C. moewusii, C. reinhardtii, and C. incerta) show considerable conservation in core functional domains while exhibiting species-specific variations. When studying these differences, researchers typically employ:

  • Sequence alignment and phylogenetic analysis to identify conserved and variable regions

  • Heterologous expression systems to produce proteins from different species

  • Spectroscopic characterization to assess pigment-binding properties

  • Functional complementation studies in mutant strains

C. reinhardtii has traditionally been the model species for such studies, but recent work with C. incerta demonstrates that other Chlamydomonas species can also be effective platforms for recombinant protein expression . These comparative studies provide insights into the evolutionary adaptations of the photosynthetic apparatus across green algae.

What methods are used to study the localization of LHCII proteins within algal cells?

Understanding the subcellular localization of LHCII proteins requires sophisticated microscopy and biochemical techniques:

  • Fluorescent protein fusions: By creating fusions between LHCII proteins and fluorescent reporters (like mCherry), researchers can track localization to specific compartments including the cytosol, cell membrane, and cell wall .

  • Compartment-specific targeting: Various signal peptides can be employed to direct recombinant proteins to different cellular locations:

    • SP7 signal peptide for secretory pathway targeting

    • SP2 ARS1 signal peptide for endoplasmic reticulum processing

    • MAW8 containing GPI anchoring sites for membrane localization

  • Subcellular fractionation: Isolating chloroplasts, thylakoid membranes, and specific membrane complexes through differential centrifugation and density gradient techniques.

  • Immunolocalization: Using antibodies specific to LHCII proteins for transmission electron microscopy visualization.

These approaches have revealed that proper localization is critical for LHCII function, with proteins needing to integrate correctly into thylakoid membranes to participate in photosynthetic light harvesting.

What are the optimal expression systems and conditions for producing functional recombinant LHCII proteins?

Producing functional recombinant LHCII proteins presents unique challenges due to their membrane-associated nature and pigment-binding requirements. Successful expression strategies include:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coliHigh yield, rapid growth, established protocolsLacks photosynthetic machinery, potential for inclusion bodiesLow temperature (16-20°C), His-tagged constructs, mature protein sequence (24-256)
Chlamydomonas reinhardtiiNative folding environment, pigment availabilityLower transformation efficiency, slower growthCulture density ~10^6 cells/ml, electroporation (2ms, 1kV/cm)
Chlamydomonas incertaAlternative native system, potentially higher expressionLess established protocolsSimilar to C. reinhardtii but with species-specific optimization

Vector Design Considerations:

  • Promoter selection (LHCBM9 promoter shows responsiveness to sulfur deprivation)

  • Inclusion of appropriate targeting sequences (transit peptides)

  • Codon optimization (though Chlamydomonas can express heterologous genes despite biased codon usage)

  • Addition of affinity tags for purification while minimizing functional interference

For highest yields, researchers should optimize culture conditions (light intensity, temperature, nutrient availability) and employ high-throughput screening techniques to identify transformants with superior expression levels .

What techniques are most effective for purifying active LHCII proteins while maintaining their pigment-binding properties?

Purification of functional LHCII proteins requires maintaining protein-pigment interactions throughout the isolation process:

Purification Workflow:

  • Cell disruption under dim light/dark conditions to prevent photooxidative damage

  • Membrane isolation through differential centrifugation

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside is often preferred)

  • Affinity chromatography leveraging histidine tags

  • Size exclusion chromatography to ensure protein homogeneity

  • Spectroscopic verification of pigment content and binding

Critical Parameters for Maintaining Activity:

  • Temperature control (4°C throughout purification)

  • Buffer composition (stabilizing agents like glycerol and specific lipids)

  • Detergent concentration (sufficient for solubilization but not disruptive to pigment binding)

  • Light exposure minimization to prevent pigment degradation

Successful purification can be verified through absorption spectroscopy, circular dichroism, and fluorescence measurements to confirm proper pigment binding and protein folding.

How can researchers optimize transformation protocols for high-yield expression of LHCII proteins in Chlamydomonas species?

Transformation optimization is crucial for achieving high expression levels of recombinant LHCII proteins:

Critical Transformation Parameters:

  • Culture preparation: Growth phase is crucial with optimal density of approximately 10^6 cells/ml

  • Transformation method selection:

    • Electroporation (2ms pulse length, 1kV/cm field strength) can yield approximately 10^3 antibiotic-resistant colonies under optimal conditions

    • Glass bead agitation (less equipment-intensive but potentially lower efficiency)

    • Biolistic delivery (effective for chloroplast transformation)

Selection Strategy:

  • Hygromycin phosphotransferase gene (hpt) has proven effective as a dominant selectable marker

  • Expression stability may require continuous selection pressure

  • Sequential selection rounds can enrich for high-expressing clones

Post-transformation Screening:

  • High-throughput fluorescence-based screening when using fluorescent protein fusions

  • Direct protein quantification via immunoblotting

  • Activity assays for functional protein assessment

How do environmental factors influence LHCII protein expression and function in Chlamydomonas species?

Environmental factors significantly modulate both expression and function of LHCII proteins in Chlamydomonas:

Light Conditions:

  • Light intensity affects LHCII protein expression levels (typically downregulated under high light)

  • Light quality (spectral composition) influences the expression ratio of different LHCII proteins

  • Research methodology: Compare protein expression using quantitative proteomics under defined light conditions

Nutrient Availability:

  • Sulfur deprivation strongly induces the LHCBM9 promoter through a specific 44-base-pair region between positions -136 and -180

  • Nitrogen limitation often leads to photosynthetic apparatus remodeling and LHCII reduction

  • Methodology: Promoter deletion analysis to identify regulatory elements

Oxygen Availability:

  • Anaerobic conditions enhance promoter activity under sulfur deprivation

  • Anaerobiosis alone is insufficient to induce certain promoters (e.g., LHCBM9)

  • Experimental approach: Controlled anaerobic chambers with appropriate gas monitoring

Temperature:

  • Affects LHCII protein stability and assembly into complexes

  • Methodology: Thermal stability assays of isolated complexes combined with in vivo fluorescence imaging

These environmental responses can be leveraged for controlled expression of recombinant proteins by manipulating culture conditions to activate specific promoters or enhance protein stability.

What analytical techniques provide the most comprehensive characterization of recombinant LHCII protein structure and function?

Comprehensive characterization of LHCII proteins requires multiple complementary techniques:

Structural Analysis:

  • Spectroscopic methods:

    • Absorption spectroscopy (350-750 nm) for pigment composition

    • Circular dichroism for protein secondary structure and pigment-pigment interactions

    • Fluorescence spectroscopy for energy transfer efficiency

  • Advanced structural techniques:

    • X-ray crystallography or cryo-electron microscopy for high-resolution structure

    • Resonance Raman spectroscopy for pigment conformation in the protein environment

    • Mass spectrometry for protein-pigment interaction mapping

Functional Assessment:

  • Energy transfer measurements:

    • Time-resolved fluorescence spectroscopy (picosecond to nanosecond timescale)

    • Transient absorption spectroscopy for ultrafast processes (femtosecond range)

  • Photoprotection analysis:

    • Non-photochemical quenching (NPQ) capacity measurement

    • Singlet oxygen production quantification

    • Thermal stability assays to assess complex integrity under stress

Comparative Analysis:

  • Side-by-side comparison with native LHCII complexes

  • Cross-species comparison of recombinant proteins

  • Structure-function correlation through site-directed mutagenesis

For meaningful results, researchers should combine multiple techniques to build a comprehensive picture of both structural and functional characteristics of the recombinant proteins.

What strategies can researchers employ to study interactions between LHCII proteins and other photosystem components?

Investigating LHCII protein interactions requires approaches that span from molecular to structural levels:

In vitro Methodologies:

  • Co-immunoprecipitation:

    • Pull-down assays using antibodies against LHCII proteins

    • Mass spectrometry identification of interaction partners

    • Chemical crosslinking to stabilize transient interactions

  • Biophysical interaction analysis:

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Native gel electrophoresis to preserve protein complexes

In vivo Approaches:

  • Fluorescence-based techniques:

    • Förster resonance energy transfer (FRET) between labeled proteins

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence recovery after photobleaching (FRAP) for dynamics

  • Genetic approaches:

    • Mutant analysis with specific LHCII proteins knocked out

    • Complementation studies with modified LHCII variants

    • Suppressor screens to identify functional relationships

Advanced structural biology:

  • Cryo-electron microscopy of intact photosystem-LHCII supercomplexes

  • Cross-linking mass spectrometry to map interaction interfaces

  • Molecular dynamics simulations to study dynamic aspects of interactions

These methodologies reveal how LHCII proteins associate with core photosystem components, participate in energy transfer networks, and reorganize during state transitions and photoprotective responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.