Recombinant Chlamydomonas reinhardtii ADP,ATP carrier protein (ABT)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The ABT gene in C. reinhardtii encodes a 308-amino acid protein (UniProt: P27080) with a molecular weight of approximately 34 kDa . Key features include:

  • Gene Structure: The single-copy nuclear gene contains four introns, none of which are conserved in other ANT genes .

  • Expression Regulation: ABT mRNA levels fluctuate under dark/light cycles (high in dark, low in early light) and decrease during heat shock .

  • Codon Usage: Reflects the biased preferences of highly expressed C. reinhardtii nuclear genes, except for rare codons ACA (Thr) and GGA (Gly) .

Recombinant Production

ABT is produced recombinantly for biochemical studies and commercial applications. Key production methods include:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purification TagsN-terminal His tag for affinity chromatography
Purity≥85% (verified by SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Biochemical Properties

Reconstituted ABT exhibits functional parallels to mitochondrial ADP/ATP carriers but with unique adaptations:

  • Substrate Specificity: Prefers ATP/ADP exchange, similar to mitochondrial ANT proteins .

  • Kinetic Parameters: Apparent K<sub>m</sub> values for ADP and ATP remain uncharacterized for ABT but are inferred to align with yeast ANT homologs (e.g., K<sub>D</sub> ~3–9 μM for ADP) .

  • Thermal Stability: Retains activity after repeated freeze-thaw cycles when stored in glycerol buffer .

Functional and Comparative Studies

  • Role in Energy Metabolism: ABT ensures ATP export from mitochondria to sustain cytosolic energy demands, analogous to its role in yeast and humans .

  • Heterologous Complementation: In yeast aac2Δ mutants, C. reinhardtii ABT partially rescues growth defects, suggesting conserved transport mechanics .

  • Divergence from Bacterial NTTs: Unlike bacterial ATP/ADP transporters (e.g., PamNTT1), ABT relies on a membrane potential for activity .

Research Applications

  • ELISA Kits: Recombinant ABT is used as an antigen in immunoassays to study antibody interactions .

  • Structural Biology: Serves as a template for crystallography trials to resolve algal-specific transport mechanisms .

  • Metabolic Engineering: Explored in synthetic biology platforms to enhance ATP flux in engineered chloroplasts .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag.
Synonyms
ABT; ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
ABT
Target Protein Sequence
MAKEEKNFMVDFLAGGLSAAVSKTAAAPIERVKLLIQNQDEMIKQGRLASPYKGIGECFV RTVREEGFGSLWRGNTANVIRYFPTQALNFAFKDKFKRMFGFNKDKEYWKWFAGNMASGG AAGAVSLSFVYSLDYARTRLANDAKSAKKGGGDRQFNGLVDVYRKTIASDGIAGLYRGFN ISCVGIVVYRGLYFGMYDSLKPVVLVGPLANNFLAAFLLGWGITIGAGLASYPIDTIRRR MMMTSGSAVKYNSSFHCFQEIVKNEGMKSLFKGAGANILRAVAGAGVLAGYDQLQVILLG KKYGSGEA
Uniprot No.

Target Background

Function
ADP:ATP antiporter, mediating the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel the cell. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating via the alternating access mechanism with a single substrate-binding site alternately exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the ADP/ATP carrier protein in Chlamydomonas reinhardtii?

The ADP/ATP carrier protein in Chlamydomonas reinhardtii serves as an integral inner mitochondrial membrane protein that facilitates the exchange of ADP and ATP between the mitochondrial matrix and the cytosol. This exchange is essential for maintaining cellular energy homeostasis by exporting ATP generated in the mitochondria to the cytosol while importing ADP for continued ATP synthesis .

Unlike in some other organisms, the ADP/ATP carrier in C. reinhardtii needs to function efficiently in both light and dark conditions, as the organism shifts between photosynthetic and respiratory metabolism. During dark periods, the carrier may be particularly important for importing ATP into the mitochondria to maintain the mitochondrial membrane potential .

How does the Chlamydomonas reinhardtii ADP/ATP carrier protein compare structurally to those in other organisms?

The Chlamydomonas reinhardtii ADP/ATP carrier protein belongs to the mitochondrial carrier family (MCF), which is characterized by a structure of approximately 300 amino acids arranged in three repeated domains . Each domain contains two transmembrane alpha-helices connected by a loop region.

While sharing the basic structural features of MCF proteins, the C. reinhardtii carrier has specific adaptations that distinguish it from carriers in other organisms:

OrganismCarrier ProteinNotable Structural FeaturesSequence Identity to C. reinhardtii
C. reinhardtiiADP/ATP carrierContains specialized domains for metabolic flexibility100%
S. cerevisiaeAac2 (major isoform)Four main sections: N-term, C1, M2, C-termModerate similarity
S. cerevisiaeAac1 and Aac3 (minor isoforms)Share 77% and 89% amino acid identity with Aac2, respectivelyLow to moderate similarity
T. bruceiTbMCP5Functions as ADP/ATP carrier with similar kinetics to yeast Aac2Low similarity

The C1 and M2 loop regions appear to be particularly important for carrier functionality, as demonstrated in yeast chimeric studies . These regions likely play similar critical roles in the Chlamydomonas reinhardtii carrier.

What expression systems are recommended for producing recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein?

For producing recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein (ABT), researchers should consider the following expression systems:

  • Heterologous expression in yeast: Saccharomyces cerevisiae strains lacking their native ADP/ATP carriers (aac1Δ aac2Δ aac3Δ) provide an excellent system for functional expression and characterization. This approach allows for complementation studies to assess functionality .

  • Escherichia coli expression systems: While challenging due to the hydrophobic nature of membrane proteins, E. coli systems can be optimized for ABT production by using specialized strains (C41, C43) and fusion tags (MBP, SUMO) to enhance solubility.

  • Native expression in Chlamydomonas reinhardtii: Expression in the native organism can be achieved using chloroplast or nuclear transformation techniques, particularly when studying in vivo function or regulation.

The methodology for heterologous expression typically involves:

  • Cloning the ABT gene into an appropriate expression vector

  • Transformation into the chosen host organism

  • Induction of expression under controlled conditions

  • Membrane fraction isolation

  • Detergent-based solubilization

  • Purification via affinity chromatography (using epitope tags like FLAG)

For functional studies, verification of correct localization to mitochondrial membranes is essential using microscopy or subcellular fractionation techniques.

What purification challenges are specific to the recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein?

Purifying recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein presents several challenges:

  • Membrane protein solubilization: As an integral membrane protein, the carrier requires careful detergent selection. Mild detergents like DDM (n-dodecyl β-D-maltoside) or digitonin are typically preferred to maintain protein structure and function.

  • Maintaining native conformation: The carrier protein can denature easily during purification, losing functionality. Including stabilizing agents like cardiolipin or specific phospholipids in purification buffers helps maintain the native conformation.

  • Oligomeric state preservation: ADP/ATP carriers often function as dimers or higher-order oligomers. Conditions must be optimized to preserve these associations during purification.

  • Tag interference: While epitope tags like FLAG have been successfully used for purification , they may interfere with protein function. C-terminal tagging is generally preferred over N-terminal tagging, which might disrupt targeting signals.

  • Protein yield optimization: Expression levels of membrane proteins are typically low. Strategies to improve yield include using strong promoters, optimized codon usage, and lower expression temperatures to allow proper folding.

A recommended purification protocol would include:

  • Membrane isolation by differential centrifugation

  • Solubilization with 1-2% selected detergent

  • Affinity chromatography using tagged constructs

  • Size exclusion chromatography for final purification

  • Verification of purity by SDS-PAGE and functional assays

How can genetic engineering be used to modify the functional properties of recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein?

Genetic engineering approaches can significantly alter the functional properties of recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein (ABT) for various research applications:

Key Methodologies:

  • Chimeric protein construction: Creating chimeras between C. reinhardtii ABT and other carrier proteins can reveal functionally important domains. This approach has proven valuable in yeast studies where chimeras between Aac1 and Aac2 identified the C1 and M2 loops as critical for functional differences . For C. reinhardtii ABT, PCR-based gene fusion techniques can create chimeras with carriers from diverse organisms to identify regions responsible for substrate specificity or regulatory properties.

  • Site-directed mutagenesis: Targeting specific residues for mutation based on sequence conservation analysis. Particularly valuable targets include:

    • Conserved charged residues in transmembrane domains that likely form the translocation pathway

    • Residues in the putative substrate binding pocket

    • Cysteine residues potentially involved in redox regulation (given the importance of redox regulation in C. reinhardtii ATP synthase)

  • Domain swapping: Exchanging entire functional domains between carriers with different properties can create ABT variants with novel characteristics. For example, replacing segments of ABT with corresponding regions from carriers with differential nucleotide affinities or transport kinetics.

Case Study from Research:
In studies with yeast carriers, one chimeric construct supported respiratory growth but failed to support growth in cells lacking mitochondrial DNA. Nine independent intragenic mutations in this chimera were identified that suppressed this phenotype, revealing regions critical for nucleotide exchange . Similar approaches could identify functionally important regions in C. reinhardtii ABT.

A systematic mutagenesis strategy might target:

Target RegionRationaleExpected Effect
Matrix-facing loopsInvolved in nucleotide bindingAltered substrate affinity
Transmembrane helicesForm the translocation pathwayChanged transport kinetics
Cytosol-facing loopsRegulatory interactionsModified regulation by cytosolic factors
N/C terminiProtein-protein interactionsAltered interactions with partner proteins

What methods are most effective for assessing the transport activity of recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein?

Evaluating the transport activity of recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein requires robust methodologies spanning in vivo, in organello, and in vitro approaches:

In Vivo Functional Complementation:

  • Heterologous expression in yeast mutants: Expression of C. reinhardtii ABT in S. cerevisiae strains lacking endogenous ADP/ATP carriers (aac1Δ aac2Δ aac3Δ) can demonstrate functionality through growth rescue on non-fermentable carbon sources . This approach tests if the recombinant protein can perform the essential functions of the native carrier.

  • Specialized yeast growth assays: More nuanced functionality can be assessed using specialized strains like sal1Δ aac2Δ (lacking both ATP-Mg/Pi carrier and ADP/ATP carrier). Such strains depend on carrier activity for ATP import into mitochondria rather than ATP export, revealing directionality preferences of the recombinant carrier .

In Organello Transport Measurements:

  • Isolated mitochondria transport assays: Using isolated mitochondria containing the recombinant carrier to measure exchange of radiolabeled nucleotides (e.g., [14C]ADP or [14C]ATP). This provides direct measurement of transport kinetics.

  • Membrane potential dependency: Assessing how membrane potential affects transport rates by using ionophores like FCCP to dissipate the potential gradient.

In Vitro Reconstitution:

  • Liposome reconstitution: Purified recombinant carrier protein can be reconstituted into liposomes loaded with specific nucleotides. External nucleotide exchange can then be measured to determine:

    • Transport kinetics (KM and Vmax values)

    • Substrate specificity profiles

    • Inhibitor sensitivity

  • Electrophysiological methods: Reconstituting the carrier into planar lipid bilayers or patch-clamped liposomes allows direct measurement of transport-associated currents, providing insights into the electrogenic nature of transport.

Transport Kinetics Analysis:
Based on similar studies with yeast carriers, researchers should examine:

  • Substrate affinity (KD for ADP binding typically in the μM range)

  • Transport velocity

  • Competitive inhibition profiles

  • Temperature dependence

Comparative Analysis Table:

Assay TypeParameters MeasuredAdvantagesLimitations
Yeast complementationGrowth rate, respirationIn vivo functionalityIndirect measurement
Radioisotope transportDirect transport ratesQuantitative kineticsRequires intact mitochondria
Liposome reconstitutionDirect exchange ratesControlled environmentComplex reconstitution process
ElectrophysiologyTransport-associated currentsReal-time measurementsTechnically challenging

How does the Chlamydomonas reinhardtii ADP/ATP carrier protein contribute to cellular energy metabolism during light and dark transitions?

The Chlamydomonas reinhardtii ADP/ATP carrier protein plays a pivotal role in coordinating energy metabolism during transitions between light and dark conditions, reflecting the organism's ability to switch between photosynthetic and respiratory metabolism:

Light Condition Energy Dynamics:
During illumination, C. reinhardtii generates ATP through photosynthesis in the chloroplast. The ADP/ATP carrier helps regulate energy distribution between organelles by:

  • Facilitating ATP export from mitochondria to cytosol when respiratory metabolism is active alongside photosynthesis

  • Regulating the balance between photosynthetically-derived ATP and mitochondrially-produced ATP

  • Supporting energetically demanding processes like flagellar motility, which requires continuous ATP supply

Dark Condition Energy Dynamics:
In darkness, C. reinhardtii shifts to respiratory metabolism, and the ADP/ATP carrier becomes crucial for:

  • Exporting mitochondrial ATP to the cytosol for cellular functions

  • Importing cytosolic ADP into mitochondria to maintain respiratory ATP production

  • Potentially importing ATP into mitochondria under certain conditions to maintain mitochondrial membrane potential

Integration with Alternative Energy Pathways:
The carrier interacts with other metabolic systems, particularly:

  • Flagellar metabolism: C. reinhardtii flagella contain glycolytic enzymes (phosphoglycerate mutase, enolase, and pyruvate kinase) that can generate ATP locally , potentially reducing dependence on ATP transport from the cell body.

  • Cyclic electron flow (CEF): During transitions or stress conditions, C. reinhardtii increases CEF around Photosystem I, potentially altering the ATP:NADPH ratio and influencing ADP/ATP carrier activity .

Regulatory Adaptations:
Unlike land plants that show strong thiol modulation of ATP synthase activity, C. reinhardtii exhibits a nonclassical redox regulation pattern. This involves a "functional disconnect" between redox switches and enzymatic activity, providing metabolic flexibility . The ADP/ATP carrier likely coordinates with this flexible ATP synthase regulation.

Experimental Data on Energy Transfer During Transitions:

ConditionATP SourcePrimary Carrier FunctionMetabolic Consequence
Light to Dark TransitionShift from chloroplast to mitochondriaATP export from mitochondriaMaintenance of cytosolic ATP levels
Dark to Light TransitionShift from mitochondria to chloroplastReduced carrier activityPhotosynthetically produced ATP becomes dominant
Flagellar FunctionBoth mitochondrial and local glycolytic ATPDistribution of ATP to flagellaSupported motility with reduced dependence on long-distance transport

What role does the recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein play in studies of mitochondrial disease models?

Recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein (ABT) serves as a valuable tool in mitochondrial disease research, offering unique advantages for studying pathologies related to mitochondrial transport dysfunction:

Model System Applications:

  • Functional conservation analysis: By comparing C. reinhardtii ABT with human mitochondrial carriers, researchers can identify conserved functional domains critical for carrier function. Disease-associated mutations in human carriers can be introduced into corresponding positions in the C. reinhardtii protein to study functional impacts in a simplified system.

  • Heterologous expression studies: Expressing C. reinhardtii ABT in yeast strains lacking endogenous carriers provides a platform for introducing disease-relevant mutations. This approach has been effective with yeast carriers (e.g., the "op1" mutation, R96H in Aac2) , which can be extended to C. reinhardtii ABT to model human mutations.

  • Structure-function relationship studies: Mitochondrial carrier deficiencies in humans often result from specific mutations affecting transport function. The C. reinhardtii carrier can be used to map critical residues and domains through systematic mutagenesis and functional testing.

Disease-Relevant Experimental Approaches:

  • Mitochondrial membrane potential measurement: Using fluorescent dyes (TMRM, JC-1) to assess how carrier mutations affect mitochondrial energization, similar to studies showing that ADP/ATP carriers support membrane potential in cells lacking mtDNA .

  • Nucleotide transport kinetics: Comparing transport kinetics between wild-type and mutated carriers provides quantitative data on how disease-associated mutations affect substrate binding and translocation rates.

  • Suppressor mutation screening: Identifying suppressor mutations that restore function to defective carriers, as demonstrated in yeast studies where nine independent intragenic mutations suppressed growth phenotypes in chimeric carriers . This approach can reveal compensatory mechanisms relevant to disease treatment.

Specific Disease Models:

Mitochondrial DiseaseRelevant Carrier FeatureResearch Application
Mitochondrial DNA depletion syndromesATP import functionStudy how carrier variants support ATP import to maintain mitochondrial functions in mtDNA-depleted cells
AAC1 deficiencySubstrate specificityModel how mutations affect nucleotide preference and transport efficiency
Mitochondrial myopathyRegulatory domainsInvestigate how mutations affect carrier regulation in response to metabolic changes
CardiomyopathyCarrier-lipid interactionsExamine how lipid environment affects carrier function and stability

Case Study from Related Research:
Studies in S. cerevisiae have shown that different ADP/ATP carrier isoforms have varying capacities to support growth in cells lacking mtDNA, with Aac2 being most efficient followed by Aac3, while Aac1 shows reduced capacity . This differential functionality provides a framework for studying how specific structural features contribute to carrier function under stress conditions, directly relevant to mitochondrial disease pathology.

How can recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein be used to study the evolutionary adaptation of energy transport systems?

Recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein (ABT) provides a unique window into the evolutionary adaptation of energy transport systems across different ecological niches and phylogenetic lineages:

Evolutionary Context and Research Applications:

  • Comparative transport studies: C. reinhardtii occupies an interesting evolutionary position as a green alga with both plant-like and protist-like characteristics. Its ADP/ATP carrier can be compared with those from land plants, fungi, and animals to understand divergent adaptations in energy transport mechanisms.

  • Functional conservation analysis: Through heterologous expression studies, researchers can determine which carrier features are evolutionarily conserved versus lineage-specific. For instance, the ability of C. reinhardtii ABT to complement yeast ADP/ATP carrier mutants would reveal functional conservation despite sequence divergence.

  • Adaptation to metabolic flexibility: C. reinhardtii can switch between photosynthetic and respiratory metabolism, requiring specialized energy transport adaptations. Its ATP synthase shows a nonclassical thiol modulation pattern, with a "functional disconnect" from redox switches that represents an adaptation to different ecological niches . The ADP/ATP carrier likely shows parallel adaptations.

Methodological Approaches:

  • Phylogenetic analysis combined with structure-function studies: By mapping functional domains onto phylogenetic trees, researchers can identify which carrier regions experienced adaptive evolution versus purifying selection.

  • Chimeric protein construction: Creating chimeras between C. reinhardtii ABT and carriers from other species (plants, fungi, animals) can identify which domains confer species-specific functionality, similar to studies with yeast carriers that identified the C1 and M2 loops as functionally important .

  • Site-directed mutagenesis of key residues: Converting evolutionarily divergent residues in C. reinhardtii ABT to those found in other species can reveal how specific amino acid changes affect carrier function across evolutionary time.

Evolutionary Insights from Comparative Data:

Organism GroupKey AdaptationFunctional ConsequenceEvolutionary Significance
Green algae (C. reinhardtii)Nonclassical thiol modulation patternMetabolic flexibility between light/dark conditionsAdaptation to variable aquatic environments
Yeast (S. cerevisiae)Multiple carrier isoforms (Aac1, Aac2, Aac3) with different regulationSpecialized carriers for different metabolic conditionsAdaptation to fermentative and respiratory metabolism
Trypanosomes (T. brucei)Single essential ADP/ATP carrier (TbMCP5)Critical for survival in procyclic formAdaptation to host environment
Land plantsStrong thiol modulation of ATP synthaseStrict regulation of ATP synthesis in darkAdaptation to terrestrial environment with predictable light cycles

Research Example:
Studies in C. reinhardtii found that replacing its ATP synthase hairpin segment with one from land plants restored classical thiol modulation, but impaired metabolism, indicating that the nonclassical regulation represents a specific adaptation to its ecological niche . Similar comparative studies with the ADP/ATP carrier could reveal how energy transport systems co-evolved with ATP synthesis mechanisms.

What techniques are available for studying the interaction between recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein and other components of the mitochondrial energy system?

Investigating the interactions between recombinant Chlamydomonas reinhardtii ADP/ATP carrier protein (ABT) and other mitochondrial energy system components requires sophisticated methodological approaches spanning biochemical, biophysical, and genetic techniques:

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged ABT (e.g., FLAG-tagged as demonstrated in yeast studies ) to pull down interacting partners from mitochondrial preparations.

    • Protocol refinement: Include chemical crosslinking steps to stabilize transient interactions

    • Controls: Compare interactions under different metabolic states (light/dark adaptation)

  • Proximity labeling approaches: Expressing ABT fused to enzymes like BioID or APEX2 that biotinylate nearby proteins, allowing identification of the proximal interactome.

    • Application: Particularly valuable for identifying weak or transient interactions

    • Analysis: Quantitative proteomics to identify differentially enriched proteins

  • Förster Resonance Energy Transfer (FRET): Using fluorescently-tagged ABT and putative interaction partners to visualize interactions in intact mitochondria.

    • Advantage: Provides spatial information about interaction sites within mitochondria

    • Limitation: Requires careful control of expression levels

Functional Interdependence Studies:

Structure-Based Approaches:

  • Cross-linking mass spectrometry: Using bifunctional crosslinkers to capture interactions between ABT and other proteins, followed by mass spectrometry identification.

    • Resolution: Provides information about specific interaction domains

    • Variation: Compare crosslinking patterns under different metabolic conditions

  • Cryo-electron microscopy: Visualizing ABT in the context of larger mitochondrial complexes or supercomplexes.

    • Application: Particularly valuable for studying interactions with the ATP synthase or respiratory complexes

    • Challenge: Requires isolation of intact complexes

Interaction Network Mapping:

Interaction TypeAnalytical MethodExpected Interacting PartnersFunctional Significance
Direct protein interactionsCo-IP, crosslinkingATP synthase, VDAC, phosphate carrierCoordinated regulation of ATP production and transport
Lipid interactionsLipidomics, reconstitution studiesCardiolipin, other phospholipidsCarrier stability and optimal function
Metabolic couplingMetabolic flux analysisKrebs cycle enzymes, respiratory complexesIntegration of transport with energy production
Regulatory interactionsPhosphoproteomics, redox proteomicsKinases, phosphatases, redox-sensitive proteinsDynamic regulation of carrier activity

Case Study Application:
Considering that C. reinhardtii shows specialized adaptations in ATP synthase regulation and contains flagellar glycolytic enzymes for local ATP production , studying how ABT functionally couples with these systems would provide unique insights into the coordinated regulation of ATP production, transport, and utilization under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.