Recombinant Chlamydomonas reinhardtii ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydomonas reinhardtii ATP Synthase Subunit b (atpF)

The recombinant Chlamydomonas reinhardtii ATP synthase subunit b (atpF) is a chloroplast-encoded protein critical for the biogenesis and function of the ATP synthase complex in photosynthetic organisms. This subunit, part of the peripheral stalk of the Fo sector, facilitates proton translocation and stabilizes the ATP synthase structure. The recombinant version (Cat.No. RFL35034CF) is produced in Escherichia coli with an N-terminal His-tag for purification and functional studies .

Role in ATP Synthase Biogenesis and Function

The atpF subunit (b) pairs with ATPG-encoded subunit b' in the peripheral stalk, forming a critical structural and functional bridge between the Fo and F1 sectors of the ATP synthase complex .

Functional Significance

  1. Proton Translocation: Facilitates proton flow through the Fo sector, driving ATP synthesis in chloroplasts .

  2. Stability: Mutants in atpF or ATPG genes (e.g., frame-shift or CRISPR knockout) result in complete loss of ATP synthase function and accumulation .

  3. Interactions: Coordinated biogenesis with subunits like atpE (ε-chain) requires nuclear-encoded factors (e.g., MDE1, an octotricopeptide repeat protein) to stabilize mRNA and enable translation .

Biosynthesis and Purification

StepDetailSource
Host OrganismE. coli (recombinant expression)
PurificationNickel affinity chromatography (His-tag)
YieldNot explicitly reported; typical E. coli yields vary by construct

Research Applications

  • Structural Studies: His-tag enables immobilization for crystallography or cryo-EM .

  • Enzyme Activity Assays: Functional testing of ATP synthase subunit interactions .

  • Biotechnological Tools: Potential use in biofuel production or artificial photosynthesis systems .

Limitations

  1. Expression Heterogeneity: While E. coli avoids the low transgene expression issues seen in Chlamydomonas , proper folding and solubility remain critical .

  2. Storage Sensitivity: Repeated freeze-thaw cycles degrade activity; aliquoting for long-term storage at -20°C/-80°C is essential .

Key Research Findings

  • Peripheral Stalk Dynamics: Mutants in atpF or ATPG disrupt ATP synthase assembly, highlighting the subunits’ role in stabilizing the Fo-F1 interface .

  • Posttranscriptional Regulation: MDE1 stabilizes atpE mRNA, ensuring coordinated synthesis of ATP synthase subunits .

Comparative Analysis of ATP Synthase Subunits

SubunitGeneRoleInteraction PartnersSource
batpFPeripheral stalk stability, proton translocationb', Fo subunits (e.g., atpH)
b’ATPGPeripheral stalk assemblyb, F1 sector (atpA, atpB)
εatpEF1 sector regulationMDE1 (OPR protein)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
atpF
Target Protein Sequence
MVFLPDNILILGHGGFGFNTNVFETNIINLAAVVGIVVSFVGKNLSSLLEDRKNTIVKNL EEANQRAIEAEQKLTAARTQLETAKKKAQEIREEGVLRATQEINNVVSQHELRLARLQEF KQETLAFYQQKAFKQAYLYVINKIMTRVRERLNKGLDSTYHVVVNNFYVSRFTQF
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembranous catalytic core, and F0, the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.