Recombinant Chlamydomonas reinhardtii ATP synthase subunit b', chloroplastic (ATPG)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chlamydomonas reinhardtii ATP Synthase Subunit b', Chloroplastic (ATPG)

The ATPG subunit (peripheral stalk subunit b') is a chloroplast-encoded component of the ATP synthase complex in Chlamydomonas reinhardtii. It plays a critical role in forming the peripheral stalk, which connects the CF1 (catalytic) and CF0 (proton channel) subunits. The recombinant ATPG protein is engineered for structural, functional, or interaction studies, typically expressed in heterologous systems like E. coli with modifications such as N-terminal His-tags for purification .

Gene and Protein Features

FeatureDescriptionSource
GeneATPG (chloroplast-encoded)
Protein Length63–209 amino acids (recombinant version)
TagN-terminal His-tag for affinity purification
Expression SystemE. coli (recombinant production)

The ATPG subunit is essential for stabilizing the ATP synthase complex. Mutants lacking ATPG exhibit complete loss of ATP synthase activity and accumulation, underscoring its indispensable role in enzyme assembly .

ATPG Mutant Phenotypes

Mutant TypeGene AffectedPhenotypeSource
Knock-outATPGNo ATP synthase accumulation; photosynthesis abolished
Knock-downATPGMinimal ATP synthase activity; reduced efficiency
Frame-shiftatpFSimilar to ATPG knock-out; peripheral stalk disruption

ATPG interacts with subunit b (encoded by atpF) to form the peripheral stalk. Disruption of this interaction halts rotational coupling between CF0 and CF1, preventing ATP synthesis .

Post-Transcriptional Control

  • MDE1 Protein: A nuclear-encoded octotricopeptide repeat (OPR) protein stabilizes ATPG mRNA, ensuring its accumulation and translation. mde1 mutants lack ATPG transcripts, leading to ATP synthase deficiency .

  • FTSH Protease: Degradation of unassembled ATP synthase subunits (e.g., AtpH) is mediated by FTSH, ensuring quality control during complex assembly .

Recombinant ATPG in Biochemical Studies

ApplicationPurposeSource
Structural AnalysisCryo-EM or X-ray crystallography to map peripheral stalk interactions
Interaction AssaysELISA or co-IP to study binding with CF0/CF1 subunits
Functional ReconstitutionRebuilding ATP synthase activity in vitro using purified subunits

The His-tagged recombinant ATPG enables efficient purification and functional testing, as demonstrated by its use in studying ATP synthase assembly dynamics .

ATPG vs. ATPB and ATPF

FeatureATPG (b')ATPB (β)ATPF (b)
Genetic OriginChloroplastChloroplastChloroplast
RolePeripheral stalkCF1 catalytic sitePeripheral stalk
Mutant SeverityLoss of ATP synthaseLoss of CF1 subunitsLoss of ATP synthase
RegulationMDE1-dependent mRNACES regulation

ATPG’s function is distinct from ATPB (β subunit) and ATPF (b subunit), though all are critical for ATP synthase assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATPF2; atpG; CHLREDRAFT_206190; ATP synthase subunit b', chloroplastic; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
63-209
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
ATPG
Target Protein Sequence
EAGKIFDFNLTLPVMAGEFLLLMVFLEKTWFTPVGKVLDERDNLIRSKLGSVKDNTGDVD KLVLEAETILKSARSDVSAMINTKKAAKQSELDKTYNEAKAKITAEVESSIAGLEQESAS MLKSLDAQVDKISAEVLKRVLPEGVRV
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. The b' subunit is a diverged and duplicated form of the b subunit found in plants and photosynthetic bacteria; it is a component of the F0 channel and part of the peripheral stalk, connecting F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of ATP synthase subunit b' (ATPG) in Chlamydomonas reinhardtii?

    The ATPG gene encodes the subunit b' of the chloroplast ATP synthase peripheral stalk in Chlamydomonas reinhardtii. This subunit is nuclear-encoded and forms part of the critical peripheral stalk structure that connects the membrane-embedded CF0 portion to the catalytic CF1 portion of the ATP synthase complex. Functionally, the peripheral stalk acts as a stator that prevents rotation of the CF1 α3β3 hexamer during ATP synthesis, while allowing the central stalk subunits (γ, δ, ε) to rotate. Recent research has demonstrated that peripheral stalk subunits, including ATPG, are essential for the biogenesis and assembly of the entire ATP synthase complex . The absence of functional ATPG prevents ATP synthase assembly and accumulation, resulting in photosynthetic deficiency and high light sensitivity in mutant strains .

  • How is ATP synthase biogenesis coordinated between nuclear and chloroplast genomes in Chlamydomonas?

    Chloroplast ATP synthase biogenesis in Chlamydomonas reinhardtii involves a complex coordination between nuclear and plastid genomes. The CF1F0 complex comprises subunits encoded by both genomes: three subunits (γ, δ, and b') are nuclear-encoded, while the remaining genes (α, β, ε, a, b, c) are organized into chloroplast operons . This dual genetic origin necessitates precise coordination between gene expression and assembly to ensure appropriate complex stoichiometry.

    The coordination process involves:

    • Transcriptional regulation: Chloroplast genes are arranged in polycistronic transcription units with complex patterns of mono-, di-, and polycistronic transcripts .

    • Nuclear factors: Nuclear-encoded proteins, such as MDE1 (an octotricopeptide repeat protein), regulate chloroplast gene expression by stabilizing specific chloroplast mRNAs (e.g., atpE mRNA) .

    • Assembly factors: Several nucleus-encoded assembly factors, including BFA1, PAB, and ATP11, facilitate the early stages of complex assembly by interacting with specific subunits .

    • Proteolysis control: The FTSH1 protease contributes to the concerted accumulation of ATP synthase subunits, regulating the turnover of unassembled components .

  • What expression vectors are available for recombinant production of ATP synthase subunits in Chlamydomonas reinhardtii?

    Several optimized vector systems have been developed for nuclear transgene expression in Chlamydomonas reinhardtii that can be applied to ATPG expression:

    • pOptimized (pOpt) vector system: This versatile toolkit includes standardized modules with unique restriction sites separating regulatory elements. It contains two separate expression cassettes - one for antibiotic resistance and another for the gene of interest .

    • Promoter options include:

      • HSP70A-RBCS2-i1 fusion promoter: Commonly used for efficient transgene expression

      • β2-tubulin promoter

      • PSAD promoter

    • Selection markers:

      • aphVII gene (conferring hygromycin B resistance)

      • aphVIII gene (conferring paromomycin resistance)

      • ble gene (conferring phleomycin resistance)

      • aadA gene (conferring spectinomycin/streptomycin resistance)

    For optimal expression, vectors should incorporate:

    • Chlamydomonas codon optimization

    • Intron inclusion (particularly RBCS2 intron 1)

    • Strong 3' UTRs (e.g., RBCS2 3' UTR)

    • If appropriate, secretion signals or subcellular targeting sequences

  • What methods are used to transform Chlamydomonas reinhardtii for ATP synthase studies?

    For ATP synthase studies in Chlamydomonas reinhardtii, transformation methods differ based on whether targeting the nuclear or chloroplast genome:

    Nuclear transformation:

    • Glass bead method: Cells are agitated with DNA and glass beads. For ATP synthase subunit expression, recovery in liquid TAP medium for 6 hours is recommended before selection .

    • Electroporation: Higher efficiency method using electrical pulses to permeabilize cell membranes.

    Chloroplast transformation:

    • Biolistic transformation (gene gun): Gold or tungsten particles coated with DNA are bombarded into cells. This method has been used successfully to express chimeric genes containing ATP synthase promoters fused to reporter genes like GUS or aadA .

    Selection strategies:

    • For nuclear transformants: Selection on TAP agar containing antibiotics (10 mg/L) under 150-μE light intensity .

    • For chloroplast transformants: Selection using spectinomycin resistance when the aadA gene is used.

    Screening approaches:

    • High-throughput screening of nuclear transformants is necessary due to position effects and variable expression levels.

    • PCR verification of integration.

    • Western or dot-blot analysis for protein expression confirmation .

Advanced Research Questions

  • How can mutations in ATPG affect ATP synthase assembly and function in Chlamydomonas?

    Recent research on Chlamydomonas reinhardtii ATP synthase assembly has revealed critical insights into ATPG's role through mutational studies:

    Types of ATPG mutations and effects:

    Mutation TypeMethodEffect on ATP SynthasePhenotypic OutcomeReference
    Transposon insertion in 3'UTRNatural mutationReduced accumulation (knock-down)Small amount of functional ATP synthase
    CRISPR-Cas9 gene editingTargeted disruptionComplete absence (knock-out)No ATP synthase function or accumulation
    Combination with FTSH1 mutationGenetic crossingAltered subunit stoichiometryIdentification of AtpH as FTSH substrate

    Mechanistic insights:

    • Complete absence of ATPG prevents ATP synthase assembly, demonstrating its essential role in complex formation.

    • The severity of ATP synthase disruption in ATPG mutants is more pronounced than in equivalent E. coli mutants, suggesting differences in assembly mechanisms between bacterial and chloroplast ATP synthases .

    • In ATPG mutants, CF1 α and γ subunits are missing entirely from thylakoid membranes, while β subunit levels are reduced to approximately 3% of wild-type levels .

    • This indicates that the peripheral stalk is crucial for the initial assembly of the CF1 catalytic component onto chloroplast membranes.

    These findings support a model where ATPG is required at an early stage of ATP synthase assembly, establishing a foundation for the incorporation of catalytic subunits into the complex .

  • What are the current approaches for optimizing recombinant ATPG expression from the nuclear genome of Chlamydomonas?

    Optimizing recombinant ATPG expression from the nuclear genome of Chlamydomonas requires addressing several challenges, particularly gene silencing and low expression levels. Current optimization approaches include:

    Genetic elements optimization:

    • Promoter combinations: Using the HSP70A promoter upstream of other promoters (e.g., RBCS2) significantly increases transgene expression frequency and levels .

    • Codon optimization: Adapting the codon usage of the ATPG sequence to match Chlamydomonas preferences enhances translation efficiency .

    • Inclusion of introns: Particularly RBCS2 intron 1, which can enhance transgene expression up to 30-fold .

    • Regulatory sequences: Optimized 5' and 3' UTRs can improve mRNA stability and translation efficiency.

    Strain selection approaches:

    • Using strains defective in silencing mechanisms: Mutants in MUT11, EZH, and other silencing pathway components show improved transgene expression .

    • Strain genetic background considerations: Different Chlamydomonas strains show varying capacity for recombinant protein expression .

    Screening strategies:

    • High-throughput screening methods: Essential due to position effect variability, using reporter fusions or direct protein detection.

    • Fusion protein approaches: Creating fusion proteins with selectable markers followed by self-cleaving peptides or skipping peptides .

    Experimental data on expression optimization:

    Optimization StrategyRelative ImprovementKey Considerations
    HSP70A promoter fusion2-fold increase in transformation efficiencyMost effective when placed upstream of other promoters
    Codon optimizationVariable (up to 5-fold)Should match GC content of highly expressed Chlamydomonas genes
    RBCS2 intron 1Up to 30-fold increasePosition matters; most effective near 5' end of coding sequence
    Using silencing-defective strainsVariable (2-20 fold)May have growth or other phenotypic abnormalities

    For ATPG specifically, targeting correct subcellular localization (chloroplast) while expressing from the nucleus requires careful design of transit peptide sequences to ensure proper import into the chloroplast .

  • How do redox regulation mechanisms impact ATP synthase function in Chlamydomonas, and can they be manipulated in recombinant systems?

    Chloroplast ATP synthase in Chlamydomonas reinhardtii possesses unique redox regulation mechanisms not found in bacterial or mitochondrial homologs:

    Redox regulation mechanism:

    • The γ subunit contains a redox-active disulfide bridge within a 9-amino acid "redox loop" (containing cysteines at positions 199 and 205 in Arabidopsis) .

    • This regulation is mediated by thioredoxin, which reduces the disulfide bond in light conditions.

    • Recent research has identified two distinct domains in the γ subunit that cooperatively regulate ATP synthase activity: the redox loop and a β-hairpin domain .

    Structural basis and experimental evidence:

    γ Subunit DomainFunction in Redox RegulationEffect of DeletionReference
    Redox loopSenses redox state via disulfide/sulfhydryl pairLoss of redox sensitivity
    β-hairpin domainInteracts with β subunit DELSEED regionHigher ATP synthesis activity regardless of redox state

    Manipulation strategies for recombinant systems:

    1. Site-directed mutagenesis: Modifying specific cysteine residues in the redox loop or acidic residues in the γ subunit can alter light-dependent regulation .

    2. Domain engineering: Creating chimeric proteins with altered redox regulation domains to modify ATP synthase activity threshold or response kinetics .

    3. Thioredoxin co-expression: Coordinated expression of thioredoxin with modified ATP synthase components can enhance redox regulation.

    4. In vitro reconstitution: Recombinant expression and purification of individual subunits allows reconstitution of the CF1 catalytic core with modified redox properties .

    Research has demonstrated that metabolism and light regulation operate via distinct mechanisms, as mutations affecting three conserved acidic residues in the γ subunit alter light-dependent but not metabolism-induced regulation . This mechanistic separation provides opportunities for selective manipulation of ATP synthase regulation in recombinant systems.

  • What strategies exist for purifying recombinant ATP synthase components from Chlamydomonas reinhardtii?

    Purification of recombinant ATP synthase components from Chlamydomonas reinhardtii requires specialized approaches due to the complex nature of the membrane-associated complex:

    Affinity tag strategies:

    Tag SystemLocationAdvantagesConsiderationsReference
    Polyhistidine (His8)N-terminus of β subunitNormal enzyme function in vivo and in vitro; Retains Mg2+-ATPase activity while bound to nickel surfaceInsertion does not impact ATP synthase assembly or function
    Strep-tag IIC-terminus of recombinant subunitMild elution conditions; High specificityMay require optimization of tag accessibility
    FLAG-tagN- or C-terminusHigh specificity antibody detectionBetter for detection than purification

    Methodological approaches:

    1. Thylakoid membrane isolation:

      • Cell disruption by French press or sonication

      • Differential centrifugation to isolate chloroplasts

      • Osmotic shock to release thylakoids

      • Sucrose gradient purification of membranes

    2. Complex extraction:

      • Solubilization with mild detergents (n-dodecyl-β-D-maltoside or digitonin)

      • Ultracentrifugation to remove insoluble material

    3. Purification strategies:

      • Immobilized metal affinity chromatography (IMAC) for His-tagged subunits

      • Size exclusion chromatography for intact complexes

      • Ion exchange chromatography as an orthogonal step

    4. Validation methods:

      • SDS-PAGE and immunoblotting

      • ATPase activity assays (stimulation by alcohol and detergents)

      • Mass spectrometry for subunit identification and stoichiometry analysis

    Engineering His-tagged ATP synthase subunits has been successfully demonstrated in Chlamydomonas reinhardtii, with the modified enzymes retaining normal function while providing a convenient purification handle . This approach enables not just purification but also immobilization of active enzyme for biophysical studies.

  • How can mutant analysis of ATP synthase genes inform about CF1-CF0 assembly pathways in Chlamydomonas?

    Mutant analysis has provided critical insights into the step-wise assembly pathway of the chloroplast ATP synthase in Chlamydomonas reinhardtii:

    Key mutants and their contributions to understanding assembly:

    Mutant TypeAffected GeneKey FindingsReference
    Point mutationsatpBMissense alterations near 5' end affect assembly; mutant atpB genes transcribed and translated normally but β subunit only 3% of wild-type levels on thylakoids
    FrameshiftatpFComplete prevention of ATP synthase function and accumulation
    CRISPR knockoutATPGEssential for ATP synthase assembly; absence prevents accumulation of CF1 components
    Transposon insertionATPG 3'UTRKnock-down allows small accumulation of functional ATP synthase
    mde1 mutantsMDE1Nuclear factor required for atpE mRNA stability; absence prevents ATP synthase biogenesis

    Assembly pathway model derived from mutant analysis:

    1. Initial stages:

      • Nuclear-encoded factors (BFA1, PAB) assist in folding of γ subunit

      • BFA1 acts as scaffold coordinating early CF1 assembly by interacting with β and γ subunits

      • PAB associates with folded γ subunit downstream of CPN60-mediated folding

    2. CF1 assembly:

      • α/β heterodimers associate with γ subunit

      • β subunit presence required for assembly of α and γ onto membranes

      • δ and ε subunits join to complete CF1

    3. CF0 integration and peripheral stalk assembly:

      • Peripheral stalk subunits (b and b') are essential for stable CF1-CF0 association

      • ATPG (b') knockout prevents ATP synthase accumulation

      • In atpF (b subunit) frameshift mutants, no functional ATP synthase accumulates

    4. Quality control mechanisms:

      • FTSH protease involvement in degrading unassembled components

      • AtpH identified as FTSH substrate through genetic crosses

    These findings reveal significant differences between chloroplast and bacterial ATP synthase assembly. In E. coli β subunit mutants, significant amounts of α and β subunits remain on membranes, while in Chlamydomonas, equivalent mutations cause complete loss of α and γ subunits from thylakoids . This suggests unique assembly requirements in chloroplasts, potentially reflecting evolutionary adaptations to the endosymbiotic origin of chloroplasts.

  • What are the current challenges and future directions for engineering recombinant ATP synthase in Chlamydomonas?

    The engineering of recombinant ATP synthase in Chlamydomonas reinhardtii faces several challenges but also offers exciting future directions:

    Current challenges:

    ChallengeDescriptionPotential Solutions
    Nuclear gene silencingTransgene expression often suppressedUsing mutant strains defective in silencing mechanisms; optimized regulatory sequences
    Coordinated expressionMultiple subunits from two genetic compartmentsBalanced expression strategies; assembly-optimized constructs
    Complex assemblyProper stoichiometry and interactions requiredCo-expression of assembly factors; engineered assembly-promoting sequences
    Post-translational modificationsRequired for proper folding and functionTargeting appropriate subcellular compartments; engineered modification sites
    Purification complexityMembrane protein complex challenging to isolateOptimized affinity tags; novel detergent strategies

    Future directions:

    1. Synthetic biology approaches:

      • Modular design of ATP synthase components with standardized interfaces

      • Creation of minimal functional units with enhanced properties

      • Application of rational design principles based on structural information

    2. Energy production optimization:

      • Engineering of γ subunit redox regulation for enhanced photosynthetic ATP production

      • Modification of peripheral stalk components to alter proton movement coupling efficiency

      • Development of ATP synthase variants with altered regulatory properties

    3. Biotechnological applications:

      • Creation of hybrid ATP synthases with novel functionalities

      • Development of nano-motor applications based on ATP synthase rotary mechanism

      • Integration of engineered ATP synthases into artificial photosynthetic systems

    4. Advanced engineering tools:

      • Application of CRISPR-Cas9 for precise genome editing of ATP synthase components

      • Development of high-throughput screening systems for optimized ATP synthase variants

      • Machine learning approaches to predict optimal modifications for desired properties

    5. Evolutionary insights:

      • Engineering ATP synthase to test evolutionary hypotheses about endosymbiosis

      • Reconstruction of ancestral ATP synthase forms to understand evolutionary transitions

      • Investigation of nucleus-chloroplast coordination mechanisms through engineered variants

    As noted in recent research, "advances in genetic manipulation and protein design tools will significantly expand the scope for testing new strategies in engineering light-driven nanomotors" . The unique properties of chloroplast ATP synthase, particularly its redox regulation mechanism, provide distinctive opportunities for engineering novel energy conversion systems with applications in both fundamental research and biotechnology.

  • How does the ATP synthase assembly pathway in Chlamydomonas differ from other photosynthetic organisms?

    The ATP synthase assembly pathway in Chlamydomonas reinhardtii exhibits several distinctive features compared to other photosynthetic organisms, reflecting its evolutionary position and unique adaptations:

    Comparative assembly pathways:

    FeatureChlamydomonas reinhardtiiLand PlantsCyanobacteriaReference
    Gene organizationGenes distributed between nuclear and chloroplast genomesSimilar distribution but different operon organizationAll genes in bacterial genome
    Assembly factorsUnique factors like MDE1 (OPR protein)Different RNA-binding protein families (PPR proteins common)Simpler assembly pathway
    Peripheral stalkATPG (b') essential for assemblySimilar requirementLess stringent requirement
    RNA processingMDE1 stabilizes atpE mRNAPPR proteins often involvedNot applicable
    Evolutionary timingMDE1-atpE interaction evolved ~300 Mya in ChlorophyceaeDifferent regulatory mechanismsNot applicable

    Key differences with detailed mechanisms:

    1. RNA processing and stability:

      • In Chlamydomonas, the nuclear-encoded octotricopeptide repeat (OPR) protein MDE1 targets the atpE 5'UTR to stabilize its mRNA

      • In land plants, pentatricopeptide repeat (PPR) proteins typically perform similar functions

      • This difference represents a relatively recent evolutionary adaptation in the CS clade of Chlorophyceae

    2. Transcription patterns:

      • Chlamydomonas has predominantly monocistronic transcripts for most chloroplast genes

      • Land plants typically have polycistronic transcription units generating complex patterns of transcripts

      • Chlamydomonas atpA gene cluster includes atpA, psbI, cemA, and atpH genes with promoters preceding atpA, psbI, and atpH, but not cemA

    3. Assembly requirements:

      • Mutations in peripheral stalk components (ATPG, atpF) in Chlamydomonas completely prevent ATP synthase assembly

      • The disruption is more severe than in E. coli equivalents, which retain significant amounts of α and β subunits on membranes

      • This suggests unique structural dependencies in the Chlamydomonas assembly pathway

    4. CF1 assembly initiation:

      • BFA1 in Chlamydomonas serves as a scaffold protein for early CF1 assembly, directly interacting with β and γ subunits

      • PAB works downstream of the CPN60 chaperone system to assist γ-subunit assembly into the CF1 catalytic core

      • These specific factors and their interactions represent unique aspects of the Chlamydomonas assembly pathway

    These differences reflect the distinct evolutionary history of Chlamydomonas and provide opportunities for comparative studies to understand the diversification of assembly pathways across photosynthetic lineages.

  • How can ATP synthase subunits be modified for specific biophysical studies in Chlamydomonas?

    ATP synthase subunits in Chlamydomonas can be strategically modified for various biophysical studies, leveraging the organism's genetic tractability and the unique properties of the chloroplast ATP synthase:

    Modification strategies and their applications:

    Modification ApproachMethodologyApplicationsKey ConsiderationsReference
    Histidine taggingInsertion of 8xHis at N-terminus of β subunit via chloroplast transformationPurification; Surface immobilization; Single-molecule studiesTag does not affect enzyme function in vivo or in vitro
    Fluorescent protein fusionsNuclear transformation with transit peptide-directed targetingReal-time visualization; FRET studies; Protein-protein interactionsMust verify proper targeting and assembly
    Site-directed mutagenesisTargeted modification of key residues (e.g., γ subunit cysteines, catalytic residues)Structure-function relationships; Regulatory mechanism studiesMay affect assembly or activity
    Domain swapping/deletionEngineering chimeric constructs with domains from different organismsEvolutionary studies; Functional domain mappingRequires careful design of junction regions

    Specific biophysical applications:

    1. Rotary mechanism studies:

      • Immobilization of His-tagged CF1 on nickel-coated surfaces while maintaining activity

      • Attachment of fluorescent probes or nanoparticles to visualize rotation

      • Single-molecule FRET between strategically placed fluorophores to detect conformational changes

    2. Redox regulation investigation:

      • Engineering of the redox loop and β-hairpin domains in the γ subunit

      • Creation of disulfide variants with altered redox potentials

      • Development of real-time redox state sensors using appropriate fluorescent proteins

    3. Structural studies:

      • Insertion of unique chemical handles for selective labeling

      • Engineering of subunits for improved crystallization properties

      • Cross-linking strategies to capture transient interactions during assembly or catalysis

    4. Assembly pathway visualization:

      • Time-resolved fluorescence microscopy with differentially labeled subunits

      • Pulse-chase studies with inducible expression systems

      • Fluorescence correlation spectroscopy to monitor complex formation kinetics

    Methodological considerations:

    • For chloroplast-encoded subunits: Biolistic transformation with homologous recombination is effective

    • For nuclear-encoded subunits: Glass bead transformation or electroporation with codon-optimized constructs

    • Validation of modification impact: Compare growth rates, photosynthetic parameters, and ATP synthase activity

    • Purification approaches: Optimize detergent conditions to maintain native interactions during extraction

    The successful engineering of a His-tagged β subunit that retains normal function both in vivo and in vitro demonstrates the feasibility of these approaches for Chlamydomonas ATP synthase . This foundation can be extended to more sophisticated modifications for advanced biophysical investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.