Recombinant Chlamydomonas reinhardtii Chlorophyll a-b binding protein CP29 (Lhcb4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Lhcb4; Chlorophyll a-b binding protein CP29; Lhcbm4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-280
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
Lhcb4
Target Protein Sequence
VFKFPTPPGTQKKAGTTATKPAPKATTKKVATSTGTRSGGVGYRKYQGDALWLPNTTRPE WLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRL APYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLP FSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKH ARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNGKGL
Uniprot No.

Target Background

Function

Function: The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. CP29 facilitates the State 1 to State 2 transition; State 1 is induced by excess photosystem I (PSI) light, and State 2 by excess photosystem II (PSII) light.

Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary role of CP29 in photosynthetic organisms?

CP29 serves multiple critical functions in the photosynthetic apparatus. Based on research with Chlamydomonas reinhardtii and higher plants, CP29 functions include:

  • Light energy collection and transfer to photosystem II (PSII) reaction centers

  • Channeling excitation energy from the major light-harvesting complex (LHCII) to the core reaction centers

  • Essential component for state transitions, particularly in C. reinhardtii

  • Potential involvement in non-photochemical quenching (NPQ), the process that dissipates excess excitation energy as heat

  • Structural stabilization of photosynthetic supercomplexes

Research with RNAi mutants in C. reinhardtii has demonstrated that CP29 is crucial for the formation of the PSI-LHCI/II supercomplex during state transitions. When CP29 is knocked down, peripheral LHCII proteins dissociate from PSII but fail to re-associate with PSI under State 2-promoting conditions, indicating that CP29 is essential for completing state transitions in this organism .

How is the structure of CP29 organized within photosynthetic membranes?

CP29 is a membrane-spanning pigment-protein complex positioned at a specific location within the PSII supercomplex. Current structural understanding relies on homology models based on the crystal structure of the major LHCII complex, as no high-resolution structure of C. reinhardtii CP29 has been determined.

Key structural features include:

  • Three transmembrane alpha-helices that anchor the protein in the thylakoid membrane

  • Multiple pigment binding sites that accommodate chlorophyll a, chlorophyll b, and carotenoid molecules

  • Specific binding sites for approximately 6 chlorophyll a and 2 chlorophyll b molecules per protein complex

  • Strategic position adjacent to the PSII core, where it serves as a linker between the major LHCII trimers and the core complex

The protein contains both lumenal and stromal domains, with pigments arranged in two layers corresponding to these domains. The lumenal layer appears to be more active in energy transfer, containing more pigments and a higher concentration of chlorophyll a binding sites .

What distinguishes C. reinhardtii CP29 from its higher plant homologs?

CP29 exhibits several important differences between C. reinhardtii and higher plants:

FeatureC. reinhardtii CP29Higher plant CP29
Transit peptideRetained after processingCleaved during import
Post-translational modificationsN-terminal acetylation and phosphorylation on Thr6Different phosphorylation pattern
Gene isoformsSingle formMultiple isoforms (e.g., Arabidopsis has Lhcb4.1, 4.2, 4.3)
Antibody reactivityNot reactive with antibodies against plant CP29Detected with antibodies against conserved epitopes
Role in state transitionsEssential; knockout prevents PSI-LHCI/II formationLess critical; knockout shows altered state transition kinetics

The transit peptide retention in C. reinhardtii CP29 is particularly notable, as it represents a unique processing mechanism not observed in other nuclear-encoded thylakoid proteins. Instead of being removed, the transit peptide undergoes methionine excision, N-terminal acetylation, and phosphorylation on threonine 6 . This unique feature may be related to the importance of this phosphorylation site in regulating CP29 function.

How is CP29 expression regulated in response to environmental conditions?

CP29 expression and post-translational modifications are tightly regulated in response to changing environmental conditions, particularly light intensity and quality. The protein undergoes phosphorylation under specific conditions, which is crucial for its role in state transitions.

In C. reinhardtii, regulation includes:

  • Phosphorylation of the N-terminal threonine residue (Thr6) in response to state transition-inducing conditions

  • Changes in expression levels during acclimation to different light intensities

  • Possible involvement in high-light response pathways related to photoprotection

The regulation of CP29 in higher plants differs somewhat, with phosphorylation occurring at different sites and in response to different stimuli. For example, in Arabidopsis, three different isoforms of CP29 (Lhcb4.1, Lhcb4.2, and Lhcb4.3) exhibit different expression patterns in response to environmental conditions .

What are the most effective protocols for expressing and purifying recombinant CP29?

Recombinant expression of CP29 typically involves the following methodological steps:

  • Gene cloning and vector construction:

    • The Lhcb4 gene is cloned from the source organism (e.g., C. reinhardtii, Zea mays, or Arabidopsis)

    • The gene is inserted into an expression vector with an appropriate promoter for E. coli expression

    • A purification tag (e.g., His-tag) may be added to facilitate purification

  • Expression conditions:

    • Transformation into an E. coli expression strain (e.g., BL21(DE3))

    • Culture at appropriate temperature (typically 25-37°C) until reaching optimal density

    • Induction with IPTG at optimized concentration and duration

    • Collection of cells by centrifugation

  • Protein extraction and purification:

    • Cell lysis using appropriate buffer systems and mechanical disruption

    • Inclusion body isolation and solubilization using detergents

    • Purification by affinity chromatography (if tagged) or ion exchange chromatography

    • Quality control using SDS-PAGE and Western blotting

The purified recombinant protein lacks pigments and requires reconstitution for functional studies .

How can researchers effectively reconstitute recombinant CP29 with pigments in vitro?

The in vitro reconstitution of CP29 with pigments requires careful handling of both the protein and pigment components:

  • Pigment preparation:

    • Chlorophyll a, chlorophyll b, and carotenoids (particularly lutein) are extracted from plant material

    • Pigments are purified using HPLC or other chromatographic methods

    • A defined pigment mixture is prepared (e.g., Chl a/b ratio of 3.5; Chl/carotenoid ratio of 3)

  • Reconstitution procedure:

    • Mixing of purified recombinant CP29 with the pigment mixture in the presence of detergents

    • Series of freeze-thaw cycles to facilitate pigment incorporation

    • Purification of reconstituted complexes by ultracentrifugation on sucrose density gradients

    • Further purification using ion exchange chromatography

  • Analysis of reconstituted complexes:

    • Determination of pigment composition by HPLC

    • Absorption, fluorescence, and circular dichroism spectroscopy to confirm proper folding

    • Functional assays to assess energy transfer properties

Importantly, research has demonstrated that CP29 shows flexibility in pigment binding, with the resulting pigment composition depending on the pigments present in the reconstitution mixture. This is in contrast to the major LHCII complex, which shows absolute selectivity for chromophore binding .

What techniques are most effective for studying state transitions involving CP29?

Several complementary techniques have proven valuable for investigating CP29's role in state transitions:

  • Fluorescence analysis:

    • 77K fluorescence emission spectra to monitor energy distribution between PSI and PSII

    • Pulse-amplitude modulation (PAM) fluorometry to quantify state transitions in real-time

    • Time-resolved fluorescence spectroscopy to study energy transfer kinetics

  • Biochemical approaches:

    • Isolation of photosynthetic supercomplexes using sucrose gradient ultracentrifugation

    • Blue native gel electrophoresis to analyze complex formation

    • Western blotting with phospho-specific antibodies to detect phosphorylation

  • Advanced spectroscopic methods:

    • 2D electronic spectroscopy to analyze energy transfer pathways

    • Circular dichroism spectroscopy to study pigment-protein interactions

    • Fluorescence lifetime measurements to quantify energy transfer rates

  • Genetic engineering:

    • Generation of CP29 knockout or knockdown mutants using RNAi or CRISPR-Cas9

    • Complementation studies with wild-type or mutated CP29 variants

    • Site-directed mutagenesis to investigate specific amino acid residues

For example, studies in C. reinhardtii using RNAi to knock down CP29 expression, combined with multiple spectroscopic and biochemical techniques, revealed that CP29 is specifically required for the re-association of mobile LHCII with PSI during state transitions .

How does CP29 contribute to energy transfer within photosynthetic complexes?

CP29 plays a sophisticated role in photosynthetic energy transfer, acting as both a light harvester and energy conduit:

  • Strategic positioning:
    CP29 is positioned between the LHCII trimers and the PSII core, allowing it to act as a bridge for excitation energy transfer. In state transitions, it also facilitates energy transfer to PSI when associated with the PSI-LHCI/II supercomplex.

  • Optimized pigment arrangement:
    The arrangement of chlorophyll molecules within CP29 facilitates efficient energy transfer both within the protein and to neighboring complexes. Studies using polarized 2D electronic spectroscopy have revealed that the relative angles between transition dipole moments within pigment pairs (e.g., A3-B3 and A5-B5 dimers) are optimized to balance internal coupling and external energy transfer .

  • Chlorophyll a/b energy funneling:
    CP29 contains both chlorophyll a and chlorophyll b, with energy transfer occurring from the higher-energy chlorophyll b to the lower-energy chlorophyll a. This directional energy transfer is evident in 2D electronic spectra, which show clear cross-peaks below the diagonal centered around ω = 14,750 cm-1, indicating energy transfer from chlorophyll b to chlorophyll a states .

  • Dual network architecture:
    CP29 maintains parallel stromal and lumenal chlorophyll networks, providing redundancy in energy transfer pathways. The lumenal network appears more active in energy conduction toward the reaction center, consistent with the concentration of chlorophyll a molecules on this side of the membrane .

How can polarized 2D electronic spectroscopy reveal structural information about CP29?

Polarized 2D electronic spectroscopy represents a powerful approach for extracting structural information directly from spectroscopic data, even in the absence of high-resolution crystal structures:

  • Principle of the technique:
    2D electronic spectroscopy uses sequences of ultrafast laser pulses to map correlations between excitation and emission energies across the entire laser bandwidth. By varying the polarization of these pulses, additional information about the relative orientation of transition dipole moments can be obtained.

  • Extraction of structural parameters:
    By analyzing the polarization dependence of cross-peaks in 2D spectra, researchers can determine the relative angles between transition dipole moments of coupled chlorophylls. For example, analysis of the chlorophyll b to chlorophyll a energy transfer cross-peaks in CP29 has revealed angles of 53° and 138° for the A5-B5 and A3-B3 dimers, respectively .

  • Comparison with homology models:
    The experimentally determined angles can be compared with those predicted by homology models based on LHCII structures. This comparison provides validation of the models and identifies areas where refinement may be needed. In the case of CP29, the measured angles differed by approximately 20° from the predicted values, suggesting potential for model improvement .

  • Functional implications:
    The structural information obtained through this technique has functional implications. The observed intermediate angles (neither parallel nor perpendicular) are optimized for both internal energy transfer within CP29 and coupling to external pigments in neighboring protein complexes .

How does the absence of CP29 affect photosynthetic performance in various organisms?

Studies of CP29-deficient mutants have revealed organism-specific effects on photosynthetic performance:

These findings collectively suggest that CP29 is unique among PSII antenna proteins and is critical for photosystem macro-organization and photoprotection, with species-specific variations in its precise functional role.

What are the challenges and strategies for creating CP29 mutants in Chlamydomonas reinhardtii?

Creating CP29 mutants in C. reinhardtii presents several challenges but can be achieved using optimized strategies:

  • Challenges in nuclear transformation:

    • Low efficiency of nuclear transformation in C. reinhardtii

    • Difficulty in achieving homologous recombination

    • Potential lethality if the gene is essential

    • Possible off-target effects with RNAi or CRISPR-Cas9 approaches

  • RNAi knockdown approach:

    • Construction of plasmids carrying hairpin RNA sequences corresponding to the Lhcb4 gene

    • Insertion of hairpin RNA sequences (≈200 bp stem structure and ≈100 bp loop structure) downstream of a suitable promoter (e.g., RBCS2)

    • Transformation and selection of transformants

    • Screening for reduced CP29 expression by Western blotting

  • Enhanced CRISPR-Cas9 using cell synchronization:

    • Cell synchronization during specific stages of the cell cycle greatly enhances transformation efficiency

    • Different cell cycle stages show differential association with non-homologous end joining (NHEJ) and/or homologous recombination (HR)

    • This approach enables targeted genetic modifications with higher precision

  • Verification and characterization strategies:

    • PCR and sequencing to confirm gene modification

    • Western blotting with CP29-specific antibodies to verify protein reduction

    • Functional assays including fluorescence measurements to assess state transitions

    • Analysis of protein complexes using native gel electrophoresis

  • Complementation studies:

    • Reintroduction of wild-type or mutated CP29 to confirm phenotype causality

    • Strategic mutations to investigate specific protein domains or residues

Successful generation of CP29 mutants provides valuable tools for understanding this protein's function and its broader role in photosynthetic processes .

How can recombinant CP29 serve as a model system for studying photosynthetic energy transfer?

Recombinant CP29 offers several advantages as a model system for investigating fundamental aspects of photosynthetic energy transfer:

  • Controllable complexity:

    • With ~8 chlorophylls per protein, CP29 provides a system of intermediate complexity between isolated pigments and larger photosynthetic complexes

    • The ability to reconstitute CP29 with different pigment compositions enables systematic investigation of structure-function relationships

  • Spectral advantages:

    • Clear separation between chlorophyll a and b bands facilitates the study of energy transfer pathways

    • Distinct spectroscopic features allow for detailed analysis of energy transfer kinetics

  • Applications in fundamental research:

    • Investigation of electronic coupling mechanisms between pigments

    • Study of coherent vs. incoherent energy transfer processes

    • Examination of how protein environment influences energy transfer properties

    • Testing of theoretical models for excitation energy transfer

  • Technical approaches with recombinant CP29:

    • Systematic modification of pigment composition during reconstitution

    • Site-directed mutagenesis to alter specific pigment binding sites

    • Integration of non-native chromophores to probe energy transfer pathways

    • Application of advanced spectroscopic techniques to track energy flow

For example, research using polarized 2D electronic spectroscopy with CP29 has provided insights into how the orientation of pigments optimizes both internal energy transfer and coupling to external complexes, contributing to our understanding of the design principles underlying efficient photosynthetic light harvesting .

What future research directions may advance our understanding of CP29 function?

Several promising research directions could significantly advance our understanding of CP29's structure, function, and applications:

These research directions will not only advance our fundamental understanding of photosynthetic light harvesting but may also contribute to applications in renewable energy, agriculture, and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.