Recombinant Chlamydomonas reinhardtii Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-500
Protein Length
full length protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
cemA
Target Protein Sequence
MYTFIYFKNPKHFNLSQPSRCTAQPFISTRNRPLSCPIPTVQPIYVTHGIILPILKGTLI SQRGVNIVPFVSKRDSSYYTDKDKVVSITYEEIGLFPRSFSRVLDRFLKQLFSDVDNLVI QEYRFYRYLFLTTIKTIFILFFVPFLVNFAAKNYIVKPITEYFWNTSHPEIFLNSYEQKR AFVELAKFEEKIYFETLVESHSHHQTHRDSKPLRENGIYFPDGEFLDNANLLSTPRSINS NTFLKQNIDISLREEKPLTLVQGVNLLEEKKELNIPLAQENIAYNNQSIPQTSFGQGNFS SLFTGDREGEETAKQNLLSQRVIGANLRQIYLPSAEGEMLPSIRGSLDSIKNKDISKIYQ EKTIELATYYNNHSIEAITNFFADLLSLFTLLYLLITLEIQINITKSFLLEVFFGLDDSK KSLLILLITDLLVGYHSSNLWELFFEFIFNHYGIPESQTGIFLLVATLPVLLDVLFKYLI FRHLNRSSPATVATYQAIIE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cemA in Chlamydomonas reinhardtii?

CemA (also known as ycf10) is an integral membrane protein located in the chloroplast envelope that plays a critical role in inorganic carbon uptake and concentration mechanisms. The protein facilitates CO₂ transport across the chloroplast envelope, particularly important under low CO₂ conditions. Methodologically, the function has been elucidated through knockout studies and complementation experiments, with mutants showing impaired growth under air-level CO₂ but normal growth under elevated CO₂ conditions. Researchers investigating cemA should consider both its structural role in the envelope membrane and its functional contribution to photosynthetic efficiency .

How is cemA genetically organized in the chloroplast genome?

The cemA gene is encoded in the chloroplast genome of C. reinhardtii, containing approximately 1050 bp and encoding a protein of about 350 amino acids. The gene features a typical chloroplast promoter structure with -10 and -35 elements, and its expression is regulated by light and carbon dioxide concentration. When designing recombinant constructs, researchers should account for the native regulatory elements to maintain proper expression patterns. Successful experimental approaches include chloroplast genome sequencing, transcriptional analysis, and promoter mapping studies to fully characterize the genetic organization .

What are the structural characteristics of cemA as a chloroplast envelope membrane protein?

CemA contains multiple α-helical transmembrane domains that anchor it within the chloroplast envelope membrane system. Proteomic analyses have identified cemA as one of the highly hydrophobic integral membrane proteins found in the chloroplast envelope. The protein features approximately 4-5 predicted transmembrane domains with both N-terminal and C-terminal regions exposed to different sides of the membrane. Experimental methodologies for structural characterization include membrane protein extraction with organic solvents, SDS-PAGE separation, and tandem mass spectrometry analysis, which have proven effective for identifying and characterizing envelope membrane proteins .

What are the most effective transformation methods for generating recombinant cemA in C. reinhardtii?

The most reliable method for cemA transformation in C. reinhardtii is biolistic (particle bombardment) transformation targeting the chloroplast genome. This approach allows site-specific integration through homologous recombination. The methodology requires:

  • Preparation of gold particles (0.6μm) coated with purified plasmid DNA

  • Bombardment of C. reinhardtii cells using optimized pressure (1100-1350 psi)

  • Selection on antibiotic-containing media (typically spectinomycin)

  • PCR verification of proper integration

  • Confirmation of homoplasmicity through multiple rounds of selection

For successful transformation, researchers should maintain cells in exponential growth phase and use freshly prepared transformation vectors. Alternative approaches such as glass bead agitation show significantly lower efficiency for chloroplast transformation .

How can expression vectors be optimized for cemA production in C. reinhardtii?

Optimizing vectors for cemA expression requires careful consideration of several elements:

Vector ElementRecommended ApproachRationale
PromoteratpA or psbAHigh expression levels under various conditions
5' UTRpsbA or rbcLEnhanced translation efficiency
Codon optimizationC. reinhardtii chloroplast codon usageAccounts for A/T rich bias in chloroplast genes
TagsC-terminal vs. N-terminal positioningN-terminal tags may interfere with membrane insertion
Selection markeraadA (spectinomycin resistance)Well-established selection system
Integration siteNeutral site (e.g., between trnE and psbH)Minimizes disruption of essential functions

Researchers should consider including the cemA native regulatory elements when attempting to complement mutant phenotypes, while using stronger heterologous elements when maximum expression is the goal .

How does heterologous cemA expression compare between C. reinhardtii and its close relative C. incerta?

Recent research demonstrates that C. incerta can serve as an alternative expression platform for chloroplast proteins. When comparing cemA or other recombinant protein expression, C. incerta has shown approximately 3.5 times higher expression levels for certain fluorescent proteins compared to C. reinhardtii. This suggests it may offer advantages for cemA studies. Methodologically, researchers can transform both species using identical vectors and compare expression through:

  • Quantitative fluorescence measurements when using fluorescent tags

  • Western blot analysis with intensity quantification

  • Functional assays to determine activity levels

  • Growth rate comparisons under various CO₂ concentrations

The higher expression in C. incerta appears to be due to intrinsic differences in translation efficiency rather than transcription levels, offering potential for higher recombinant protein yields .

What purification strategies are most effective for recombinant cemA?

Purifying hydrophobic membrane proteins like cemA presents significant challenges. The most effective protocol involves:

  • Preparation of chloroplast envelope membranes through differential centrifugation

  • Solubilization using appropriate detergents (recommended: n-dodecyl-β-D-maltoside at 1-2%)

  • Affinity chromatography utilizing engineered tags (His-tag or FLAG-tag)

  • Size exclusion chromatography for further purification

  • Verification of purity by SDS-PAGE and Western blotting

Critical factors affecting purification efficiency include detergent concentration, salt concentration (typically 100-300mM NaCl), and buffer pH (optimally 7.5-8.0). Researchers should maintain samples at 4°C throughout the procedure and include protease inhibitors to prevent degradation .

How can researchers effectively localize cemA within the chloroplast membrane system?

Accurate localization of cemA requires complementary approaches:

Each method has strengths and limitations, so combining approaches provides the most reliable localization data .

What analytical techniques are most appropriate for assessing cemA function in recombinant systems?

Functional characterization of cemA requires multiple analytical approaches:

TechniqueApplicationMethodological Considerations
Carbon uptake assaysMeasure CO₂/HCO₃⁻ fluxUse radiolabeled carbon (¹⁴C) or pH-dependent methods
Growth rate analysisCompare growth under varying CO₂Standardize cell density and media composition
Chlorophyll fluorescenceAssess photosynthetic efficiencyUse PAM fluorometry to measure quantum yield
Genetic complementationRestore function in cemA mutantsVerify complete replacement of mutant phenotype
Mass spectrometryIdentify interaction partnersUse crosslinking to capture transient interactions

Researchers should include appropriate controls, particularly wild-type and cemA knockout strains alongside recombinant expressing lines, to effectively evaluate functional restoration or enhancement .

How can researchers investigate protein-protein interactions involving cemA in the chloroplast envelope?

Investigating cemA interactions requires specialized approaches for membrane proteins:

  • Split-ubiquitin yeast two-hybrid assay: Modified for membrane proteins, this technique can identify potential interaction partners when traditional Y2H fails.

  • Co-immunoprecipitation with crosslinking: Chemical crosslinkers (e.g., DSP or formaldehyde) can stabilize transient interactions before solubilization.

  • Proximity labeling: Fusion of cemA with enzymes like BioID or APEX2 allows biotinylation of nearby proteins, which can then be purified and identified.

  • Blue native PAGE: This technique preserves protein complexes during electrophoresis, allowing identification of cemA-containing complexes.

  • Förster resonance energy transfer (FRET): When combined with fluorescent protein tagging, FRET can detect direct interactions in vivo.

These methods should be used complementarily, as each has specific strengths and limitations for membrane protein interaction studies .

What approaches can resolve contradictory data regarding cemA topology in the membrane?

Conflicting reports on cemA topology can be addressed through multiple complementary methods:

  • Cysteine scanning mutagenesis: Systematically introducing cysteine residues throughout the protein and testing their accessibility to membrane-impermeable reagents.

  • Glycosylation mapping: Adding glycosylation sites at various positions and determining which become glycosylated based on their exposure to the lumen.

  • Fluorescence protease protection (FPP) assay: Monitoring the degradation patterns of fluorescently tagged cemA regions when exposed to proteases from different compartments.

  • Computational prediction validation: Testing multiple topology prediction algorithms against experimental data to identify the most accurate model.

  • Cryo-electron microscopy: For direct visualization of the protein in its native membrane environment.

Researchers should implement at least three independent methods to establish topology with high confidence. Discrepancies often result from different experimental conditions or analysis of cemA fragments rather than the complete protein .

How can CRISPR-Cas9 technology be applied to study cemA function in C. reinhardtii?

While CRISPR-Cas9 typically targets nuclear genes, adapted approaches can study chloroplast-encoded cemA:

  • Transplastomic CRISPR-Cas9: Expression of Cas9 and guide RNAs from the chloroplast genome itself, allowing direct editing of chloroplast DNA.

  • Nuclear-encoded, chloroplast-targeted Cas9: Using transit peptides to direct nuclear-expressed Cas9 to the chloroplast for editing.

  • Point mutation introduction: Creating specific mutations to study structure-function relationships in cemA without complete gene knockout.

  • Promoter modification: Altering expression levels through targeted changes to regulatory regions.

  • Domain swapping: Replacing specific domains with corresponding regions from homologous proteins to identify functional elements.

Technical considerations include optimizing guide RNA design for the A/T-rich chloroplast genome and developing appropriate screening methods to identify successfully edited clones. The primary challenge remains the efficient delivery and expression of editing components within the chloroplast compartment .

How does cemA structure and function differ between C. reinhardtii and other photosynthetic organisms?

Comparative analysis reveals both conservation and divergence:

OrganismcemA CharacteristicsFunctional Implications
C. reinhardtii4-5 transmembrane domains, ~350 amino acidsCO₂ uptake, carbon-concentrating mechanism
Higher plantsSlightly smaller (280-320 amino acids)Less characterized function, possible proton extrusion
CyanobacteriaPresent as cotA/cymA homologsSimilar carbon uptake function
Non-green algaeVariable presence and structureReflects different carbon acquisition strategies

Methodologically, researchers can perform complementation studies by expressing cemA homologs from different organisms in C. reinhardtii cemA mutants to assess functional conservation. Computational approaches including multiple sequence alignment and evolutionary rate analysis provide insights into conserved domains and functional constraints across species .

What can interspecific hybridization between C. reinhardtii and C. incerta reveal about cemA evolution and function?

Recent research demonstrates successful interspecific hybridization between C. reinhardtii and C. incerta, offering new research opportunities:

  • Hybrid analysis can reveal which cemA allele provides superior function under various conditions.

  • Segregation analysis in hybrid offspring can identify genetic elements controlling cemA expression and function.

  • The relative conservation of cemA between these species (compared to other genes) suggests strong evolutionary pressure to maintain function.

  • Hybrids may exhibit novel phenotypes due to interactions between cemA and other cellular components from different species.

Methodologically, researchers can generate hybrids through cellular fusion techniques, verify hybrid status through molecular markers, and assess recombination rates. When analyzing hybrids, factors such as chloroplast inheritance patterns must be considered, as chloroplast genes typically show maternal inheritance in Chlamydomonas species .

How can proteomics approaches identify the complete interactome of cemA in the chloroplast envelope?

Comprehensive proteomics strategies for mapping the cemA interactome include:

  • Quantitative immunoprecipitation combined with knockdown (QUICK): This technique combines co-immunoprecipitation with stable isotope labeling to distinguish specific from non-specific interactions.

  • Membrane yeast two-hybrid (MYTH) screening: Modified yeast two-hybrid system specifically designed for membrane proteins can identify binary interactions.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map interaction interfaces by measuring changes in deuterium uptake upon complex formation.

  • Protein correlation profiling: Analyzing co-migration patterns of proteins during chromatographic separation or gradient centrifugation can identify potential complexes.

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linking followed by MS analysis can capture both stable and transient interactions within native membrane environments.

The combination of these approaches can overcome the challenges of studying membrane protein interactions, including maintaining protein stability during solubilization and distinguishing true interactions from non-specific associations. Data integration through network analysis tools helps visualize the complete interactome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.