Recombinant Chlamydomonas reinhardtii Cytochrome b6-f complex iron-sulfur subunit, chloroplastic (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-206
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
petC
Target Protein Sequence
AAASSEVPDMNKRNIMNLILAGGAGLPITTLALGYGAFFVPPSSGGGGGGQAAKDALGND IKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENK FKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAESGLVTFSTWTETDFRTGLEPWWA
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein. Note=The transmembrane helix obliquely spans the membrane in one monomer, and its extrinsic C-terminal domain is part of the other monomer.

Q&A

What is the cytochrome b6-f complex in Chlamydomonas reinhardtii and what role does petC play?

The cytochrome b6-f complex is an essential membrane protein complex in the thylakoid membrane that facilitates electron transfer between photosystems II and I during photosynthesis. Research has identified that the C. reinhardtii complex contains four large subunits (cytochrome f, cytochrome b6, subunit IV, and the Rieske iron-sulfur protein/petC) and at least four smaller subunits (PetG, PetL, PetM, and PetN) . The petC subunit contains an iron-sulfur cluster that is critical for electron transport within the complex.

Methodological approach: To study the composition and function of the cytochrome b6-f complex, researchers typically employ:

  • Chloroplast isolation using differential centrifugation

  • Membrane solubilization with mild detergents

  • Biochemical purification via chromatography

  • Subunit identification through mass spectrometry analysis

  • Functional reconstitution in liposomes

How does the structure of the cytochrome b6-f complex influence its function?

The structural organization of the cytochrome b6-f complex directly impacts its electron transport capabilities and interactions with other photosynthetic components. Research using chimeric proteins has revealed that the spatial arrangement of subunits is critical, particularly the relationship between the C-terminus of subunit IV and the N-terminus of PetL .

Methodological approach: Researchers can investigate structure-function relationships through:

  • Creation of chimeric proteins fusing different subunits

  • Site-directed mutagenesis of key residues

  • Analysis of electron transport activity through spectroscopic methods

  • Assessment of state transitions, which can be disrupted in chimeric mutants while maintaining Q-cycle activity

  • Development of structural models to explain functional alterations

What expression systems yield optimal results for recombinant petC in C. reinhardtii?

For recombinant expression of petC, researchers can utilize either nuclear or chloroplast transformation systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest Applications
ChloroplastHigher expression levels, precise integration via homologous recombination, polycistronic expressionLimited post-translational modificationsProteins requiring high yield, multi-protein assemblies
NuclearTargeting to various cellular compartments, post-translational modificationsRandom integration, silencing issuesProteins requiring specific modifications or targeting

Methodological approach: For chloroplast expression, the pASapI vector system has demonstrated success with various recombinant proteins, utilizing endogenous promoters and UTRs such as atpA . For nuclear expression, vectors containing strong promoters combined with strains that reduce silencing can improve outcomes, though expression levels generally remain lower than industrial standards .

What promoters and regulatory elements maximize recombinant protein expression in C. reinhardtii chloroplasts?

The choice of promoter and regulatory elements significantly impacts recombinant protein expression levels in C. reinhardtii chloroplasts:

Promoter/UTRRelative ExpressionApplicationsNotes
atpA promoter/5'UTRHighConstitutive expressionSuccessfully used for VFP expression
psaA promoter/5'UTRMedium-HighExpression of chaperonesUsed for Spy chaperone co-expression
rbcL 3'UTRN/A (stabilizes mRNA)Most recombinant proteinsCommonly used to enhance transcript stability

Methodological approach: To determine optimal expression elements:

  • Design constructs with different promoter/UTR combinations

  • Include epitope tags (e.g., HA-tag) for detection if antibodies aren't available

  • Evaluate expression using western blotting and functional assays

  • Consider co-expression with chaperones like E. coli Spy to enhance protein accumulation

What cultivation conditions maximize recombinant protein yield in C. reinhardtii?

Optimization of growth conditions is critical for maximizing recombinant protein expression in C. reinhardtii:

ParameterOptimal ConditionEffect on Expression
Temperature30°CIncreased protein accumulation
Growth ModeMixotrophic (light + acetate)Higher biomass and protein yield
Light IntensityModerate (specific to protein)Balanced growth and expression
MediaTAP medium with acetateSupports mixotrophic growth

Methodological approach: Researchers should:

  • Conduct systematic optimization experiments varying one parameter at a time

  • Use fluorescent reporter proteins (e.g., VFP) to monitor expression in real-time

  • Employ flow cytometry for quantitative analysis of expression levels

  • Be aware that optimal conditions may be protein-specific (conditions for VFP may not translate directly to other proteins like Cpl-1)

How can protein-constrained modeling help optimize recombinant protein production in C. reinhardtii?

Advanced modeling approaches can provide insights into metabolic constraints affecting recombinant protein production:

Methodological approach: Protein-Constrained Flux Balance Analysis (PC-FBA) can be used to:

  • Integrate transcriptomic data with metabolic models

  • Identify metabolic bottlenecks limiting protein production

  • Optimize proteome allocation between growth and recombinant protein synthesis

  • Predict metabolic shifts under different growth conditions

The PC-model refines basic metabolic models by adding protein concentrations as variables, constraining respective reaction fluxes, and establishing a total proteome budget (typically 150 mg per gram of dry cell weight) . This approach provides more accurate phenotype simulations without requiring manual setting of exchange reaction boundaries.

How should I design experiments to study the assembly of recombinant petC into the cytochrome b6-f complex?

Studying the assembly process requires careful experimental design:

Methodological approach:

  • Create constructs with detectable tags (e.g., HA epitope) on petC

  • Design chimeric proteins to investigate spatial relationships within the complex

  • Employ inducible expression systems to track assembly kinetics

  • Use biochemical analysis to assess complex integrity:

    • Blue-native PAGE to analyze intact complexes

    • Immunoprecipitation to identify interacting partners

    • Fractionation to determine subcellular localization

Chimeric fusion proteins between subunits (e.g., subunit IV and PetL) have successfully demonstrated that neither a free subunit IV C-terminus nor a free PetL N-terminus is required for complex assembly, providing insights into subunit arrangement .

What strategies help overcome low expression or misfolding of recombinant petC?

When encountering challenges with recombinant petC expression:

Methodological approach:

  • Co-express molecular chaperones to assist folding:

    • E. coli Spy chaperone has shown success in increasing protein accumulation

    • Design expression vectors with both the target protein and chaperone (e.g., under psaA promoter/5'UTR)

  • Optimize codon usage for the C. reinhardtii chloroplast

  • Modify culture conditions based on systematic testing:

    • Temperature optimization (30°C has shown improved results)

    • Growth mode selection (mixotrophic conditions often preferred)

  • Consider alternative expression hosts:

    • C. incerta has demonstrated 3.5-fold higher expression of some recombinant proteins

    • Interspecies cellular fusion can generate genetic hybrids with potentially improved expression

How can we use chimeric constructs to study structural relationships within the cytochrome b6-f complex?

Chimeric proteins serve as powerful tools for investigating structural relationships:

Methodological approach:

  • Design fusion proteins linking different subunits:

    • C-terminus of subunit IV fused to N-terminus of PetL

    • Include flexible linkers to minimize structural disruption

  • Analyze biochemical and functional properties of chimeric complexes:

    • Complex assembly via immunoblotting

    • Electron transport activity through spectroscopy

    • State transitions through fluorescence measurements

  • Correlate functional changes with structural alterations:

    • Loss of state transitions in chimeric mutants despite maintained Q-cycle activity suggests specific structural requirements for certain functions

Such approaches have revealed that in the wild-type complex, the N-terminus of PetL and the C-terminus of subunit IV are spatially proximate, contributing to our understanding of complex architecture .

What are emerging approaches for enhancing recombinant protein expression in Chlamydomonas species?

Recent research highlights several promising strategies:

Methodological approach:

  • Explore alternative Chlamydomonas species:

    • C. incerta has demonstrated higher expression of some recombinant proteins (3.5x higher fluorescence for mCherry)

    • Comparable secretion capacity for enzymes like xylanase

  • Utilize interspecies cellular fusion:

    • Generate genetic hybrids between C. reinhardtii and C. incerta

    • Exchange recombinant protein genes and selectable markers through recombination

  • Apply proteome-constrained modeling:

    • Use PC-FBA to identify metabolic bottlenecks

    • Optimize proteome allocation based on transcriptomic data

  • Develop synthetic biology tools:

    • Design synthetic promoters optimized for expression

    • Create improved vectors for targeted integration

How should I analyze the functional impact of petC modifications on photosynthetic electron transport?

Comprehensive functional analysis requires multiple complementary approaches:

Methodological approach:

  • Spectroscopic analysis:

    • Measure characteristic absorption of the iron-sulfur cluster

    • Determine redox potentials of electron transfer components

  • Electron transport assays:

    • Measure whole-chain electron transport (water to NADP+)

    • Assess segment-specific activity (PSII to cytochrome b6-f)

  • Physiological measurements:

    • Analyze state transitions, which can be specifically disrupted in chimeric mutants

    • Evaluate Q-cycle activity, which can remain functional despite state transition loss

  • Structural correlations:

    • Develop models explaining how specific modifications affect function

    • Propose testable hypotheses about structure-function relationships

This multi-faceted approach enables researchers to distinguish between direct effects on electron transport and secondary impacts on complex assembly or stability.

What computational approaches can improve our understanding of petC function within the metabolic network?

Advanced computational methods provide system-level insights:

Methodological approach:

  • Proteome-constrained modeling:

    • Integrate transcriptomic data with metabolic models

    • Simulate different growth conditions (autotrophic, mixotrophic, heterotrophic)

    • Predict metabolic flux distributions

  • Comparative analysis:

    • Compare optimal proteome allocation under different conditions:

      • Autotrophy: 80.2% of proteome allocated to photosynthesis

      • Heterotrophy: 43.2% allocated to photosynthesis, 15.0% to glycolysis and TCA cycle

  • Time-course analysis:

    • Track metabolic shifts in response to environmental changes

    • Correlate gene expression changes with metabolic fluxes

These approaches provide insights beyond what can be gleaned from experimental data alone, enabling researchers to understand how petC function integrates into broader cellular metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.