Recombinant Chlamydomonas reinhardtii Cytochrome b6-f complex subunit petO, chloroplastic (PETO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PETO; Cytochrome b6-f complex subunit petO, chloroplastic; Cytochrome b6-f complex subunit V; suV; Cytochrome b6-f-associated phosphoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
52-198
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
PETO
Target Protein Sequence
GVVLQQPVLKKAFQDDTPAAPPPKREFRGLAPPALPQSDAPNVAAEKPKKAEVVESTSGG LDPRSVALPGALALTIGGFVAASKIDGSFNDWFMEAVVRDSNNYAGYEATLKSENGVTFP KVAAGGTKKVKAATGSKKGGFPFGGKK
Uniprot No.

Target Background

Function

The cytochrome b6-f complex facilitates the linear transmembrane electron transport between photosystem II and I, and participates in cyclic electron flow around photosystem I.

Database Links
Protein Families
PetO family
Subcellular Location
Plastid, chloroplast thylakoid membrane.

Q&A

What is PETO and what structural characteristics does it possess?

PETO is a 15.2-kDa polypeptide encoded by the nuclear gene PETO in Chlamydomonas reinhardtii. It represents subunit V of the cytochrome b6f complex, a critical component of the photosynthetic electron transport chain. Structurally, PETO possesses a single transmembrane alpha-helix topology with two large hydrophilic domains extending on both the stromal and lumenal sides of the thylakoid membranes. The N-terminus of the protein is located on the lumenal side of the thylakoid membrane, which has important implications for its function and interactions with other proteins . This distinctive structure enables PETO to serve as an interface between the membrane-embedded components of the cytochrome b6f complex and the soluble proteins involved in electron transport and regulatory processes.

How do researchers confirm PETO as a legitimate subunit of the cytochrome b6f complex?

PETO can be verified as a bona fide subunit (subunit V) of the cytochrome b6f complex through three primary experimental approaches. First, PETO consistently copurifies with other established cytochrome b6f subunits during the initial stages of purification procedures, indicating a stable physical association with the complex . Second, cytochrome b6f mutants that accumulate reduced levels of the complex show corresponding deficiencies in PETO, providing genetic evidence for its integration into the complex . Third, colocalization studies demonstrate that PETO migrates alongside cytochrome f between stacked and unstacked membrane regions during state transitions . These complementary lines of evidence, incorporating biochemical purification, genetic analysis, and localization studies, collectively establish PETO as an integral component of the cytochrome b6f complex rather than a transiently associated protein.

What is the functional significance of PETO in photosynthetic electron flow?

PETO plays a crucial role in fine-tuning photosynthetic electron transport, particularly in balancing linear electron flow (LEF) and cyclic electron flow (CEF). While LEF produces both ATP and NADPH, CEF generates only ATP, making it essential for balancing the ATP:NADPH ratio required for carbon fixation . PETO contributes specifically to the stimulation of CEF when cells encounter anoxic conditions, serving as a regulatory switch . Under oxic conditions, PETO co-fractionates with other thylakoid proteins involved in CEF, including ANR1, PGRL1, and FNR, forming a functional module . Experimental evidence from PETO-knockdown strains demonstrates disrupted interactions between these CEF proteins, resulting in altered electron flow patterns . Additionally, PETO appears to be involved in photoprotection pathways associated with b6f function, suggesting a role in safeguarding the photosynthetic apparatus during stress conditions .

What experimental systems are commonly used to study PETO?

Chlamydomonas reinhardtii serves as the primary model organism for studying PETO function. This unicellular green alga offers several advantages for photosynthesis research: it is easily cultured under laboratory conditions, has a relatively short generation time, and possesses a fully sequenced genome with established transformation protocols . Researchers typically employ several experimental approaches to investigate PETO, including:

TechniqueApplication in PETO ResearchKey Advantages
Gene knockdown/knockoutCreating PETO-deficient strainsAllows direct assessment of functional consequences
Protein purificationIsolation of cytochrome b6f complexEnables biochemical characterization of PETO
Sucrose gradient ultracentrifugationFractionation of protein complexesReveals PETO's associations with other proteins
Affinity purificationIdentification of interaction partnersDiscovered ANR1 as a major PETO interactant
Chlorophyll fluorescenceMonitoring electron transport activityNon-invasive measurement of photosynthetic function
Time-resolved spectroscopyAnalyzing electron transfer kineticsProvides detailed insights into PETO's role in CEF

These complementary approaches allow researchers to elucidate PETO's structural properties, interaction partners, and functional contributions to photosynthetic electron transport .

How does PETO contribute to membrane reorganization during anoxia?

PETO plays a critical role in the anoxia-triggered reorganization of thylakoid membranes, a process essential for optimizing photosynthetic electron flow under oxygen-limited conditions. When Chlamydomonas cells are placed in anoxia, a significant membrane restructuring occurs, resulting in a subpopulation of Photosystem I (PSI) and cytochrome b6f co-fractionating with cyclic electron flow (CEF) effectors in sucrose gradients . This spatial rearrangement appears to facilitate increased CEF, allowing for ATP production without corresponding NADPH generation. In PETO-knockdown strains, this reorganization is significantly impaired, suggesting PETO functions as an essential structural component or signal mediator during adaptation to anoxic conditions . The mechanistic details likely involve PETO's ability to undergo reversible phosphorylation, potentially serving as a redox-sensitive switch that triggers membrane protein redistribution in response to changing oxygen availability.

What is the relationship between PETO phosphorylation and its function?

PETO is characterized as a transmembrane thylakoid phosphoprotein, indicating its activity is regulated through reversible phosphorylation events . This post-translational modification appears critical for PETO's role in cyclic electron flow regulation. The phosphorylation state of PETO likely influences its interactions with other proteins involved in CEF, particularly ANR1, which has been identified as a major interaction partner through affinity purification studies . Recent research on the cytochrome b6f subunit PetD provides insight into how phosphorylation may regulate electron transport complexes. The phosphomimic mutation PetD T4E inhibits STT7 kinase activity, revealing a feedback mechanism regulating phosphorylation . Given that PETO and STT7 are both involved in electron flow regulation, similar phosphorylation-dependent mechanisms might control PETO function. Researchers investigating this relationship typically employ phosphoproteomic analyses, site-directed mutagenesis of potential phosphorylation sites, and in vitro kinase assays to elucidate the precise relationship between PETO phosphorylation status and its functional properties.

How does the ANR domain in PETO interactors contribute to cyclic electron flow?

The identification of ANR1 as a major PETO interactant provides significant insight into PETO's functional mechanism. ANR1 contains two ANR domains, which are remarkably also found in the N-terminal region of NdhS, the ferredoxin-binding subunit of the plant ferredoxin-plastoquinone oxidoreductase (NDH) . This structural homology suggests an evolutionary co-option of the ANR domain by two unrelated cyclic electron flow systems - PGR and NDH. The ANR domain likely functions as a sensor of the redox state of the membrane, facilitating electron transfer or regulatory interactions in response to changing cellular conditions . This domain appears to serve as a critical interface for ferredoxin binding, allowing electron transfer from reduced ferredoxin to membrane-bound electron carriers. Experimental approaches to study the ANR domain's contribution typically include structure-function analyses through domain swapping experiments, site-directed mutagenesis of conserved residues, and computational modeling of protein-protein interactions based on structural data.

What analytical methods are recommended for investigating PETO's role in state transitions?

State transitions represent a dynamic regulatory mechanism that redistributes excitation energy between Photosystem I and Photosystem II. PETO's colocalization with cytochrome f during migration between stacked and unstacked membrane regions during state transitions suggests its involvement in this process . To comprehensively investigate PETO's role in state transitions, researchers should employ a multi-faceted analytical approach:

Analytical MethodSpecific ApplicationData Interpretation
77K Fluorescence SpectroscopyQuantifying energy distribution between PSI and PSIIChanges in emission peak ratios (F735/F685) indicate altered excitation energy distribution
Phosphoprotein AnalysisDetecting phosphorylation of LHCII and PETOWestern blotting with phospho-specific antibodies or mass spectrometry-based phosphoproteomics
Confocal MicroscopyVisualizing protein movement during state transitionsFluorescently-tagged PETO allows tracking of its localization relative to photosystems
Electron MicroscopyExamining thylakoid membrane ultrastructureReveals physical changes in membrane organization associated with PETO function
Proteomic Analysis of Membrane FractionsIdentifying PETO-associated proteins during transitionsDifferential centrifugation followed by mass spectrometry identifies interaction partners
FRET AnalysisMeasuring protein proximity changesReveals dynamic interactions between PETO and other proteins during state transitions

These complementary techniques provide a comprehensive view of how PETO contributes to the structural and functional changes associated with state transitions, particularly in relation to STT7 kinase activity which is known to be central to this process .

What approaches are most effective for generating and validating PETO-knockdown strains?

Creating reliable PETO-knockdown strains is essential for functional studies. Several complementary approaches have proven effective for manipulating PETO expression levels in Chlamydomonas reinhardtii:

  • RNA interference (RNAi): Designing hairpin constructs targeting specific regions of the PETO mRNA sequence, followed by transformation using glass bead or electroporation methods. Expression is typically driven by constitutive promoters such as HSP70-RBCS2 or inducible systems like NIT1.

  • CRISPR/Cas9 genome editing: Designing guide RNAs targeting the PETO locus, followed by transformation with Cas9 and selection markers. This approach allows for precise gene editing, including the introduction of point mutations or complete gene knockouts.

  • Antisense expression: Creating constructs expressing antisense PETO RNA to suppress endogenous gene expression.

Validation of knockdown efficiency should employ multiple methods:

Successful knockdown strains typically exhibit disrupted interactions between CEF proteins and impaired membrane reorganization during anoxia, confirming PETO's functional significance in these processes .

What techniques are recommended for analyzing PETO's interaction with ANR1?

Characterizing the interaction between PETO and ANR1 requires a comprehensive suite of biochemical, biophysical, and genetic approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against either PETO or ANR1 to pull down protein complexes, followed by immunoblot analysis to detect the presence of interaction partners. This confirms physical association in vivo.

  • Yeast two-hybrid assays: Testing direct protein-protein interactions by expressing PETO and ANR1 as fusion proteins with DNA-binding and activation domains, respectively. Positive interactions activate reporter gene expression.

  • Bimolecular Fluorescence Complementation (BiFC): Expressing PETO and ANR1 as fusion proteins with complementary fragments of a fluorescent protein. Interaction brings the fragments together, restoring fluorescence that can be visualized by microscopy.

  • Förster Resonance Energy Transfer (FRET): Tagging PETO and ANR1 with compatible fluorophores to measure energy transfer, indicating close proximity (<10 nm) in living cells.

  • Surface Plasmon Resonance (SPR): Quantitatively measuring binding kinetics and affinity constants using purified proteins.

  • Crosslinking mass spectrometry: Identifying specific contact residues between the proteins after chemical crosslinking and subsequent proteolytic digestion and mass spectrometry analysis.

Affinity purification studies have already identified ANR1 as a major interactant of PETO, and disruption of this interaction in PETO-knockdown strains correlates with altered cyclic electron flow, suggesting its functional significance . The ANR domains in ANR1 likely play a crucial role in this interaction, potentially serving as redox sensors that regulate electron transfer based on the membrane's redox state.

How can researchers effectively measure cyclic electron flow changes in PETO mutants?

Measuring cyclic electron flow (CEF) in PETO mutants requires specialized techniques that distinguish it from linear electron flow. The following methodological approaches are particularly effective:

  • P700 redox kinetics measurement: Monitoring the re-reduction kinetics of P700+ (the primary electron donor of PSI) after a short pulse of far-red light, which preferentially excites PSI. Slower re-reduction kinetics in PETO mutants would indicate impaired CEF.

  • Electrochromic shift (ECS) measurements: Quantifying the membrane potential generated by electron transfer across the thylakoid membrane. The decay kinetics after light-to-dark transition provides information about proton conductivity and CEF contribution.

  • Chlorophyll fluorescence analysis: Measuring parameters such as NPQ (non-photochemical quenching) and ETR (electron transport rate) under conditions that favor CEF, such as anoxia or high light. PETO mutants typically show altered NPQ induction kinetics, reflecting changes in proton gradient formation through CEF .

  • Thylakoid membrane fractionation: Using sucrose gradient ultracentrifugation to isolate membrane fractions and analyze the distribution of PSI, cytochrome b6f, and CEF effectors. In wild-type cells under anoxia, a subpopulation of PSI and cytochrome b6f co-fractionates with CEF effectors, a reorganization that is impaired in PETO-deficient strains .

  • NADPH fluorescence measurement: Monitoring changes in NADPH levels during light-to-dark transitions, which reflects the balance between LEF (which produces NADPH) and CEF (which does not).

The combined application of these techniques provides comprehensive insights into how PETO contributes to the stimulation of CEF, particularly under anoxic conditions where its function appears most critical .

How should researchers analyze membrane reorganization data in the context of PETO function?

Membrane reorganization analyses require systematic approaches to data collection and interpretation when studying PETO's role. Researchers should implement the following analytical framework:

  • Differential centrifugation profiles: When analyzing sucrose gradient fractionation data, compare the distribution profiles of marker proteins (PSI, PSII, cytochrome b6f) between wild-type and PETO-deficient strains under both oxic and anoxic conditions. Quantify the relative abundance of each protein complex across gradient fractions using immunoblotting or mass spectrometry.

  • Co-localization coefficient calculation: For microscopy-based studies, calculate Pearson's correlation coefficient or Manders' overlap coefficient to quantify the degree of spatial overlap between PETO and other proteins of interest during membrane reorganization events.

  • Statistical validation: Apply appropriate statistical tests (ANOVA with post-hoc analysis) to determine if observed differences in protein distribution patterns between wild-type and PETO mutants are significant, using multiple biological replicates (n≥3).

  • Temporal analysis: Track the kinetics of membrane reorganization following the transition from oxic to anoxic conditions, creating time-course profiles that reveal how quickly PETO facilitates reorganization.

In wild-type Chlamydomonas, anoxia triggers a reorganization where PSI and cytochrome b6f co-fractionate with CEF effectors in sucrose gradients, while this reorganization is impaired in PETO-knockdown strains . This observation suggests PETO functions as an essential structural component or signal mediator during adaptation to anoxic conditions. The temporal correlation between membrane reorganization and changes in electron flow parameters provides crucial insights into the mechanistic basis of PETO's function.

What controls and experimental considerations are essential when studying PETO phosphorylation?

Researching PETO phosphorylation requires rigorous controls and specific experimental considerations:

  • Phosphorylation-specific controls:

    • Include both positive controls (known phosphoproteins) and negative controls (dephosphorylated samples) in all phosphoprotein detection assays

    • Use phosphatase treatment of sample aliquots to confirm phosphorylation-specific signals

    • Apply multiple detection methods (Pro-Q Diamond staining, phospho-specific antibodies, and mass spectrometry) to validate phosphorylation status

  • Experimental conditions affecting phosphorylation:

    • Carefully control light conditions (intensity, duration, quality) as photosynthetic protein phosphorylation is often light-dependent

    • Monitor and maintain consistent redox conditions during sample preparation

    • Consider the effects of anoxia and other stress conditions on phosphorylation states

  • Sample preparation considerations:

    • Include phosphatase inhibitors in all extraction buffers

    • Minimize sample processing time to prevent dephosphorylation

    • Use quantitative approaches (e.g., stable isotope labeling) for accurate phosphorylation level comparison

  • Data analysis approach:

    • Perform site-specific phosphorylation analysis using mass spectrometry to identify exact phosphorylation sites

    • Quantify the stoichiometry of phosphorylation at specific residues

    • Correlate phosphorylation levels with functional parameters (e.g., CEF rates)

Recent findings regarding the phosphomimic mutation PetD T4E inhibiting STT7 kinase activity reveal how phosphorylation can create feedback mechanisms regulating electron transport . Similar regulatory mechanisms likely control PETO function, making careful phosphorylation analysis crucial for understanding its role in photosynthetic regulation.

How can researchers integrate data from multiple analytical techniques to comprehensively understand PETO function?

Developing a comprehensive understanding of PETO function requires integrating data from diverse experimental approaches. Researchers should implement the following integration strategy:

  • Multi-level data correlation: Create correlation matrices between parameters measured at different organizational levels:

    • Molecular level: PETO phosphorylation state, protein-protein interactions

    • Biochemical level: Electron transport rates, proton gradient formation

    • Physiological level: Growth rates, stress tolerance, photosynthetic efficiency

  • Temporal integration: Align time-course data from different techniques to establish cause-effect relationships, particularly when studying transitions between oxic and anoxic conditions where PETO's role in CEF becomes evident .

  • Conditional analysis: Compare data patterns across multiple environmental conditions (light intensity, oxygen availability, nutrient status) to identify condition-specific aspects of PETO function.

  • Multi-strain comparisons: Systematically analyze wild-type, PETO-knockdown, and complemented strains to establish direct relationships between PETO levels and observed phenotypes.

  • Computational modeling: Develop quantitative models integrating experimental data to simulate electron flow dynamics and predict system behavior under conditions not directly tested.

This integrated approach has revealed that PETO contributes to CEF stimulation during anoxia, interacts with ANR1, and plays a role in membrane reorganization . The ANR domain present in ANR1, which also appears in the ferredoxin-binding subunit of NDH, likely serves as a redox sensor, suggesting evolutionary co-option of this domain by different CEF systems . Such comprehensive integration allows researchers to place PETO within the broader context of photosynthetic regulation.

What are the emerging research questions regarding PETO function?

Several critical questions remain unanswered about PETO's function and regulation that represent promising avenues for future research. As our understanding of this protein evolves, researchers should consider addressing the following priorities:

  • Structural determination of PETO alone and in complex with interaction partners, particularly ANR1, using cryo-electron microscopy or X-ray crystallography to reveal the molecular basis of their functional relationship.

  • Comprehensive mapping of the PETO phosphoproteome under various environmental conditions to identify all phosphorylation sites and their functional significance.

  • Investigation of potential additional functions beyond CEF regulation, particularly in photoprotection pathways associated with cytochrome b6f function .

  • Comparative analysis of PETO homologs across diverse green algal species to understand evolutionary conservation and divergence of function.

  • Development of systems biology approaches to integrate PETO function into whole-cell models of photosynthetic electron transport regulation.

The study of PETO contributes to our fundamental understanding of photosynthetic regulation and may ultimately inform strategies for enhancing photosynthetic efficiency in both natural and engineered systems. The protein's role in balancing ATP and NADPH production through CEF regulation represents a crucial adaptation for photosynthetic organisms responding to changing environmental conditions . Continuing research on this fascinating protein will undoubtedly reveal new insights into the complex regulatory networks governing photosynthesis.

How might PETO research methodology evolve in the coming years?

The methodological approaches for studying PETO function are likely to evolve significantly as new technologies become available. Future advancements may include:

  • Application of advanced imaging techniques such as super-resolution microscopy and correlative light and electron microscopy to visualize PETO localization and membrane reorganization at unprecedented resolution.

  • Implementation of optogenetic approaches to control PETO phosphorylation or protein interactions with light, allowing precise temporal manipulation of its function.

  • Development of high-throughput phenotyping platforms to assess PETO mutant phenotypes across a wide range of environmental conditions.

  • Utilization of single-cell omics techniques to understand cell-to-cell variability in PETO expression and function within populations.

  • Application of in situ structural biology approaches to study PETO's interactions and conformational changes in its native membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.