Recombinant Chlamydomonas reinhardtii Cytochrome c biogenesis protein CCS1, chloroplastic (CCS1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydomonas reinhardtii Cytochrome c Biogenesis Protein CCS1, Chloroplastic (CCS1)

The recombinant Chlamydomonas reinhardtii Cytochrome c biogenesis protein CCS1, chloroplastic (CCS1) is a critical component of the system II pathway for c-type cytochrome assembly in chloroplasts. This protein facilitates the attachment of heme groups to apocytochrome precursors, enabling the maturation of functional cytochromes c6 and f, which are essential for photosynthetic electron transport. The recombinant version is produced in E. coli and includes an N-terminal His tag for purification and stability .

Molecular Architecture

CCS1 is a polytopic membrane protein with:

  • Three transmembrane domains anchoring it to the thylakoid membrane.

  • A large soluble C-terminal domain (93–613 amino acids) exposed to the lumen, critical for interacting with apocytochrome substrates .

  • A stromal loop suspected to stabilize protein interactions or facilitate heme transfer .

Functional Interactions

CCS1 operates in a multisubunit complex with CcsA (a plastid-encoded membrane protein) and other nuclear-encoded CCS components (CCS2–CCS6). Together, they:

  • Relay heme from the stroma to the lumen via conserved histidine residues.

  • Coordinate heme attachment to apocytochrome precursors, requiring the WWD motif in CcsA for stereospecific ligation .

Recombinant Production and Properties

PropertySpecification
SpeciesChlamydomonas reinhardtii
SourceExpressed in E. coli
TagN-terminal His tag
Protein LengthFull-length mature protein (93–613 amino acids)
Purity>90% (SDS-PAGE confirmed)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL), with optional 5–50% glycerol

Key Notes:

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Sequence: Includes conserved residues critical for heme coordination (e.g., histidines in transmembrane domains) .

Genetic and Functional Studies

  • Mutant Analysis: ccs1 mutants fail to assemble cytochrome f and c6, indicating CCS1’s essential role in heme attachment .

  • Domain Importance:

    • The C-terminal soluble domain is indispensable; truncation abolishes function .

    • Conserved histidines in CCS1 and CcsA are required for heme coordination and transfer .

Mechanistic Insights

  • Heme Relay: CCS1 and CcsA form a channel for heme transport, with the WWD motif in CcsA binding heme via tryptophan residues .

  • Cross-Linking: Cysteine substitutions in the WWD domain of CcsA (homologous to CCS1’s conserved regions) enable heme covalent attachment, confirming its role in cytochrome maturation .

Experimental Uses

  • Protein Purification: The His-tagged recombinant CCS1 enables efficient affinity chromatography for structural or biochemical studies .

  • Functional Assays: Used to study cytochrome assembly in vitro, elucidating conserved mechanisms across eukaryotes and prokaryotes .

Broader Implications

  • Evolutionary Conservation: CCS1 homologs exist in cyanobacteria and algae, highlighting shared pathways for cytochrome biogenesis .

  • Disease Models: Dysfunctional CCS1 pathways may inform studies on mitochondrial disorders linked to cytochrome c deficiencies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CCS1; CHLREDRAFT_111044; CHLREDRAFT_195343; Cytochrome c biogenesis protein CCS1, chloroplastic; C-type cytochrome synthesis protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
93-613
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
CCS1
Target Protein Sequence
GGGVASPRTLVQSNAVQVAWRRLMKELSSLPRAIAIMALIAVLSGLGTFIPQNKSIEYYL VNYPDGAEKVLGFLTGDLILTLQLDHIYTADYFYLSMGLLAASLAACTYTRQWPAVKVAQ RWRFLTQPKSLLKQGRTEVLPNARVSDLGAILLQRGYQVFVKDGSLYGFKGLAGKLGPIG VHAALLLCLFGTAWSGFGTLKGNVMCPEGQDFQVASFLQPSSPIASMPASASNVIHVNKF TIDYRPDGSVAQFYSDLSLLDPAQGGKEMMRKTISVNDPFRFNGVTMYQTDWSLSAVTLR VLGQDAPLARAAQAAEAQAAASTSGPTSSASSTSDALPQQRTAFNLPMASLEGKPGVAGR LWATFLPLAEPGQDGSAPKGISILARDPQSVVFYDAKGQFVGVRRPGSGKPIEVEGLALV VEDVTGATGLELKSDPGVPAVYAGFGGLMVTTLISYLSHSQVWALQQGSSLFVSGRTNRA KLAFDRELDDILNAVPELPPTAATTVASSASTAAPAPTAKQ
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links
Protein Families
Ccs1/CcsB family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CCS1 in Chlamydomonas reinhardtii?

CCS1 is a nuclear-encoded protein required for the post-translational processes involved in the biogenesis of the photosynthetic apparatus in Chlamydomonas reinhardtii chloroplasts. Specifically, it is essential for the formation of chloroplast c-type holocytochromes, including cytochrome b6f complex and cytochrome c6 . Functional analysis reveals that CCS1 is a highly divergent component of the system II type c-type cytochrome biogenesis pathway . The protein participates in transmembrane delivery, reduction, and ligation of apoprotein and heme during cytochrome c assembly. Without functional CCS1, cells exhibit pleiotropic c-type cytochrome deficiency, demonstrating its critical role in photosynthetic electron transport chain formation .

How is CCS1 structurally organized and what are its key domains?

CCS1 has a complex membrane topology with both transmembrane and soluble domains. Based on analysis of the Synechocystis homolog CcsB, the protein possesses:

  • A large soluble lumenal domain at the C-terminus

  • Three closely spaced transmembrane domains in the N-terminal portion that anchor the protein to the thylakoid membrane

  • A stromal loop region between transmembrane domains

The computed structure model of CCS1 from Chlamydomonas reinhardtii (613 amino acids) has a global pLDDT (predicted Local Distance Difference Test) confidence score of 78.56, indicating a relatively confident structural prediction . The entire C-terminal soluble domain is essential for CCS1 function, and the stromal loop appears important for maintenance of CCS1 in vivo .

What expression systems are recommended for producing recombinant CCS1?

For recombinant expression of CCS1 or related System II cytochrome c biogenesis proteins, Escherichia coli has been successfully used as a heterologous expression system. When expressing System II components, consider the following methodological approach:

  • For optimal expression, use E. coli strains lacking endogenous cytochrome c biogenesis systems

  • If expressing the CcsBA fusion protein (related to CCS1/CcsB function), Helicobacter hepaticus CcsBA yields high levels of recombinant product

  • Tag the protein with affinity tags (e.g., GST) for purification purposes

  • Include proper redox control during expression, as disulfide bond formation proteins (Dsb) affect CcsBA function (DsbC and DsbD under aerobic conditions; only DsbD under anaerobic conditions)

It is essential to maintain proper membrane insertion during expression, as CCS1 is an integral membrane protein with critical transmembrane domains required for function.

What methods are available for functional assays of CCS1?

When assessing CCS1 functionality, researchers can employ several complementary approaches:

  • Genetic complementation assays: Transformation of CCS1-deficient mutants (e.g., abf3 in C. reinhardtii) with wild-type or modified CCS1 constructs to restore cytochrome accumulation

  • Cytochrome accumulation analysis: Spectroscopic or immunological detection of c-type cytochromes (especially cytochrome b6f complex and cytochrome c6) as indicators of CCS1 function

  • Site-directed mutagenesis: Modification of specific residues (especially His274 which is essential, while Cys199 appears non-essential) to assess their contribution to protein function

  • Protein accumulation analysis: Assessment of CCS1 levels in various genetic backgrounds (ccs2, ccs3, ccs4, ccsA mutants) to analyze potential interactions with other Ccs components

These methodological approaches enable comprehensive evaluation of wild-type and mutant CCS1 proteins and their role in cytochrome c biogenesis.

How can researchers effectively distinguish between CCS1's direct biochemical roles and its potential chaperoning functions?

Distinguishing between the direct biochemical and chaperoning functions of CCS1 requires a multi-faceted experimental approach:

  • Domain-specific mutational analysis: Create targeted mutations in different CCS1 domains to separate functions. For example, in the related CcsBA system, mutations in the transmembrane histidines affect heme binding specifically, while other mutations may affect protein-protein interactions or chaperoning functions .

  • In vitro reconstitution assays: Purify recombinant CCS1 and assess its ability to facilitate cytochrome c assembly in a defined biochemical system. Compare rates of assembly with various substrate proteins to identify potential chaperoning preferences.

  • Binding affinity measurements: Quantify the binding of CCS1 to different forms of cytochrome c apoprotein (folded vs. unfolded) using techniques such as isothermal titration calorimetry or surface plasmon resonance. Higher affinity for unfolded states would suggest chaperoning activity.

  • Cross-linking studies: Perform chemical cross-linking followed by mass spectrometry to identify interaction surfaces between CCS1 and substrate proteins at different stages of cytochrome maturation.

By analogy to the yeast copper chaperone for SOD1 (also called CCS1 but functionally distinct), which exhibits both metal delivery and chaperoning functions, researchers should test whether Chlamydomonas CCS1 similarly stabilizes immature cytochromes before their final maturation .

What are the optimal conditions for purifying functional CCS1 protein for in vitro studies?

Purification of membrane proteins like CCS1 requires specialized approaches to maintain functionality:

Table 1: Optimized Purification Protocol for CCS1

StepProcedureCritical ParametersRationale
1. ExtractionSolubilize membranes with gentle detergents (e.g., n-dodecyl-β-D-maltoside)Detergent concentration: 1-2% initially, 0.02-0.05% in buffersPreserves transmembrane domain structure
2. Affinity PurificationUse GST or His-tagged fusion constructsBuffer: 50 mM Tris-HCl pH 8.0, 150 mM NaClBased on successful purification of related CcsBA
3. Redox ControlInclude reducing agents (e.g., 1-5 mM DTT)Oxygen-free environment for anaerobic preparationsPrevents oxidation of critical cysteines
4. Storage10% glycerol, -80°C storageFlash freeze in small aliquotsMaintains protein stability

When purifying CCS1, it's critical to verify that the protein retains heme-binding capability, as detergent-solubilized GST-tagged CcsBA (related to CCS1) has been shown to purify with heme trapped in the protein . Functionality tests should include spectroscopic verification of bound heme and the ability to facilitate cytochrome c assembly in reconstitution assays.

How do mutations in conserved histidine residues affect the heme-binding and transfer functions of CCS1?

Based on studies of related System II cytochrome c biogenesis proteins, conserved histidine residues play a crucial role in heme binding and transfer:

  • Structural impact: His274 within the last transmembrane domain preceding the large lumenal domain is absolutely required for c-type cytochrome assembly . Mutation of this residue abolishes CCS1 function.

  • Functional complementation: Remarkably, for the related CcsBA system, the loss of function in histidine mutants can be partially complemented by adding the histidine side chain analogue imidazole to growth media , suggesting these residues directly coordinate heme.

  • Heme channel formation: The conserved histidines in transmembrane domains appear to form a well-defined heme binding site within a channel comprised of transmembrane domains (e.g., TMD3 and TMD8 in CcsBA) .

For experimental assessment of histidine mutations in CCS1:

  • Create site-directed mutations of conserved histidines

  • Test for complementation of ccs1 mutants in vivo

  • Attempt chemical rescue with imidazole supplementation

  • Measure heme binding spectroscopically in purified mutant proteins

  • Use computational modeling to predict structural changes in the transmembrane heme channel

What are the thermodynamic parameters governing heme transfer from CCS1 to target cytochromes?

The thermodynamics of heme transfer is a critical aspect of CCS1 function. By analogy to copper transfer studied in yeast CCS1 (a different protein with similar metal transfer function), researchers can investigate heme transfer using the following methodological approach:

  • Binding affinity determination: Use spectroscopic techniques to measure the affinity of heme for different sites in CCS1 and target cytochromes. This can be done using direct competition assays with small-molecule heme chelators, similar to how Cu(I) binding was studied with BCA and BCS chelators .

  • Thermodynamic gradient establishment: For efficient heme transfer, a favorable thermodynamic gradient must exist from the donor site in CCS1 to the acceptor site in the target cytochrome. Measure the relative binding constants (K_d values) for each site.

  • Transfer kinetics measurement: Monitor the rate of heme transfer from CCS1 to apo-cytochromes using stopped-flow spectroscopy with fluorescence or absorbance detection.

Table 2: Predicted Thermodynamic Parameters for Heme Transfer

ParameterDonor (CCS1)Intermediate SitesAcceptor (Cytochrome c)Transfer Direction
Binding Affinity (K_d)ModerateProgressively tighterTightestThermodynamically favorable
Coordination EnvironmentHis/CysVariableHis/Met in c-type cytochromesChanges during transfer
Redox State RequirementsReduced (Fe²⁺)Maintained reducedReduced for attachmentRequires reducing environment

For successful heme transfer, the binding affinity should progressively increase along the transfer pathway, creating a "downhill" thermodynamic gradient from CCS1 to the target cytochrome.

How does CCS1 interact with other components of the System II cytochrome c biogenesis pathway?

CCS1 functions within the System II cytochrome c biogenesis pathway, interacting with several other components:

  • Protein-protein interactions: CCS1 levels are reduced in ccs2, ccs3, ccs4, and ccsA mutant strains, suggesting functional interactions with these other components . To study these interactions:

    • Perform co-immunoprecipitation experiments

    • Use yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

    • Apply chemical cross-linking followed by mass spectrometry to identify interaction surfaces

  • Functional complex formation: The System II machinery likely forms a functional complex. To investigate:

    • Use blue native PAGE to isolate intact complexes

    • Apply single-particle cryo-EM to determine the structure of the entire cytochrome c biogenesis complex

    • Use genetic complementation assays with domain swap constructs to identify interaction domains

  • Temporal sequence of interactions: Determine the order of assembly and interaction using pulse-chase experiments and synchronized induction of system components.

The minimal functional System II consists of CcsB and CcsA (related to CCS1), but in vivo, the pathway also involves DsbD and CcsX for optimal function . Understanding these interactions is essential for reconstituting the complete cytochrome c biogenesis system.

What controls should be included when assessing CCS1 function in cytochrome c biogenesis assays?

Rigorous experimental design for CCS1 functional studies should include the following controls:

  • Positive controls:

    • Wild-type CCS1 complementation in ccs1 mutant backgrounds

    • Known functional homologs from related species (e.g., Synechocystis CcsB)

  • Negative controls:

    • Empty vector transformations

    • CCS1 with mutations in critical residues (e.g., His274)

    • Heat-inactivated protein preparations for in vitro studies

  • Specificity controls:

    • Assessment of multiple c-type cytochromes (e.g., cytochrome b6f complex, cytochrome c6)

    • Measurement of non-c-type cytochromes that should be unaffected by CCS1 mutation

  • System-specific controls:

    • Test function under both aerobic and anaerobic conditions, as redox requirements differ

    • Include control for proper membrane insertion using protease protection assays

    • Verify heme availability using heme synthesis inhibitors or supplementation

These comprehensive controls ensure that observed effects are specifically attributable to CCS1 function rather than to secondary effects or experimental artifacts.

How can researchers effectively use Chlamydomonas as a model system for CCS1 studies?

Chlamydomonas reinhardtii offers unique advantages for studying CCS1 and chloroplast protein function:

  • Genetic approaches:

    • Generate insertional mutations using glass bead-mediated transformation, as was done to generate the original ccs1 mutants

    • Perform tetrad analysis by crossing mutants with wild-type strains

    • Use CRISPR gene editing for precise modification of the CCS1 locus

  • Cell biology techniques:

    • Take advantage of Chlamydomonas' ability to grow as haploids or diploids

    • Use synchronized cultures to study temporal aspects of cytochrome biogenesis

    • Exploit the ability to grow cells photosynthetically or heterotrophically to isolate effects on photosynthetic complexes

  • Biochemical methods:

    • Isolate intact chloroplasts for in organello studies of cytochrome biogenesis

    • Purify thylakoid membranes to study membrane-associated processes

    • Perform in vitro translation using chloroplast extracts to study co-translational processes

Chlamydomonas combines "excellent genetics, such as the ability to grow cells as haploids or diploids and to perform tetrad analysis," with robust biochemical approaches, making it "simply unmatched in terms of speed, efficiency, cost, and the variety of approaches that can be brought to bear on a question" related to fundamental aspects of chloroplast biology .

How should researchers address discrepancies between in vitro and in vivo results for CCS1 function?

When confronting contradictory results between in vitro and in vivo experiments on CCS1 function, apply this systematic troubleshooting approach:

  • Identify potential sources of discrepancy:

    • Lack of essential cofactors or interacting partners in vitro

    • Improper folding or membrane insertion of recombinant protein

    • Incorrect redox environment affecting critical cysteine residues

    • Absence of spatial organization present in the chloroplast

  • Reconciliation strategies:

    • Develop more sophisticated in vitro systems that better mimic the chloroplast environment

    • Use semi-in vitro approaches such as isolated chloroplasts or thylakoid membranes

    • Create chimeric proteins with domains from in vitro-active homologs

    • Apply computational modeling to identify structural differences between in vitro and in vivo conformations

  • Validation approach:

    • Test predictions from both in vitro and in vivo models with new experimental designs

    • Use multidisciplinary techniques to examine the same question from different angles

    • Apply structural biology approaches to compare protein conformations in different contexts

Table 3: Common Discrepancies and Resolution Strategies

Discrepancy TypePossible CausesResolution Strategies
Activity levelsMissing cofactors, incorrect foldingSupplement in vitro systems with chloroplast extracts
Substrate specificityAltered protein conformationCompare binding affinities with different substrates
Redox sensitivityDifferent redox environmentTest function across a range of defined redox potentials
Protein stabilityMembrane environment differencesUse nanodiscs or liposomes to mimic native environment

What bioinformatic approaches can reveal evolutionary relationships and functional conservation of CCS1 across species?

Understanding CCS1 evolution requires sophisticated bioinformatic analyses:

  • Sequence-based approaches:

    • Perform multiple sequence alignments of CCS1 homologs across diverse photosynthetic organisms

    • Identify conserved residues, especially in functional domains

    • Construct phylogenetic trees to trace the evolutionary history of CCS1

    • Compare with the evolution of cytochrome c proteins to identify co-evolutionary patterns

  • Structure-based methods:

    • Use the computed structure model of CCS1 (pLDDT: 78.56) as a basis for structural comparisons

    • Perform structure-based alignments with homologs and related proteins

    • Identify conserved structural features that may not be apparent in sequence alignments

  • Functional prediction:

    • Map conserved residues onto the structural model to predict functional sites

    • Compare with known functional residues (e.g., His274) to validate predictions

    • Identify potential species-specific adaptations in the cytochrome c biogenesis pathway

CCS1 shows significant identity (25-33%) with Ycf44 from the brown alga Odontella sinensis, the red alga Porphyra purpurea, and the cyanobacterium Synechocystis strain PCC 6803, along with limited sequence similarity (11-12%) with ResB of Bacillus subtilis and an open reading frame in a homologous operon in Mycobacterium leprae . These relationships provide a starting point for more comprehensive evolutionary analyses.

What are promising approaches for studying the structural dynamics of CCS1 during the cytochrome c maturation process?

Future research into CCS1 structural dynamics should explore:

  • Advanced structural biology techniques:

    • Apply cryo-electron microscopy to capture different conformational states

    • Use hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Implement single-molecule FRET to measure conformational changes during cytochrome binding and heme transfer

    • Explore solid-state NMR techniques for membrane-embedded domains

  • Computational approaches:

    • Perform molecular dynamics simulations based on the AlphaFold model (pLDDT: 78.56)

    • Model the energetics of conformational changes during the cytochrome maturation cycle

    • Predict heme binding and transfer pathways through the protein

  • Functional dynamics studies:

    • Design conformationally constrained CCS1 variants to test the importance of structural flexibility

    • Create synthetic cytochrome c variants that probe specific steps in the maturation process

    • Develop real-time assays to monitor structural changes during heme transfer

The current structural model suggests that CCS1, like the related CcsBA system, may contain a channel formed by transmembrane domains that creates a heme binding site accessible from both sides of the membrane . Understanding the dynamics of this channel during cytochrome maturation represents a particularly promising research direction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.