Recombinant Chlamydomonas reinhardtii Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
ycf4
Target Protein Sequence
MTQNNILIRRYIIVGERRFSNYWWAIVIFLGSCGFLATGICSYLGIPNWLSLLNIGTTFS SETETLASGIVPFFPQGLLMSFYGSLGFLLSIYWSLLIFWNVGGGFNEFNKKEGFVRIFR WGYPGKNRKIDLSYSLKDIEAIRVELKQGLDAQRTIYLRLKGKREIPLTGIGQPLTLKEI EKQASELANFLQVSLEA
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Gene References Into Functions
  1. Ycf4 plays a crucial role in the early stages of photosystem I complex assembly. PMID: 19667102
Database Links
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its primary function in photosynthetic organisms?

Ycf4 (Hypothetical Chloroplast Reading Frame 4) is a thylakoid membrane protein that plays an essential role in the assembly of photosystem I (PSI) complex. In Chlamydomonas reinhardtii, it functions as a critical assembly factor rather than a structural component of the final PSI complex. Research has demonstrated that Ycf4 is indispensable for the accumulation of functional PSI in C. reinhardtii, with Ycf4-deficient mutants being unable to develop photoautotrophically due to their inability to assemble PSI complexes properly . The protein appears to act as a scaffold for PSI assembly, mediating interactions between newly synthesized PSI polypeptides . Interestingly, while Ycf4 is absolutely essential in C. reinhardtii, its homolog in cyanobacteria (Orf184) is not strictly required for photosynthesis, though its absence does affect pigment composition and reduces PSI levels .

What is the molecular structure and localization of Ycf4?

Ycf4 in Chlamydomonas reinhardtii is a 22 kDa protein (approximately 197 amino acids in length) encoded by the chloroplast genome . The protein is embedded in the thylakoid membrane of chloroplasts. Structural studies have revealed that Ycf4 forms part of a large complex exceeding 1500 kDa, with electron microscopy showing particles measuring approximately 285 × 185 Å . This complex appears to exist in multiple oligomeric states. Ycf4 interacts closely with other proteins, particularly COP2 (an opsin-related protein) and several PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . These interactions suggest that the Ycf4 complex serves as an assembly platform for PSI components.

What methods are used to generate and validate Ycf4 knockout mutants?

Researchers typically employ the following methods to generate and validate Ycf4 knockout mutants:

  • Gene Disruption: The biolistic transformation method is commonly used to disrupt the ycf4 gene. For example, researchers have inserted the aadA expression cassette (conferring spectinomycin resistance) at specific restriction sites within the ycf4 gene . In C. reinhardtii, insertion at the EcoRI site located 137 nucleotides downstream from the ycf4 initiation codon has been successful .

  • Selection and Purification: Transformants are selected based on antibiotic resistance (typically spectinomycin) and subjected to multiple rounds of single colony purification under selective conditions to ensure homoplasmy (complete replacement of all wild-type copies of the chloroplast genome) .

  • Verification of Homoplasmy: Southern blot hybridization is used to confirm complete gene disruption. In one study, DNA from wild-type and transformants was digested with XbaI and EcoRV and hybridized with ycf4 gene-specific probes. The expected size increase (typically 2 kbp for the aadA cassette) in the hybridizing fragment confirms successful disruption .

  • Protein Expression Analysis: Western blotting with Ycf4-specific antibodies is employed to confirm the absence of the protein in knockout mutants. For example, polyclonal antibodies raised against recombinant Ycf4 detect a 22 kDa protein in wild-type extracts but not in successful knockout mutants .

How can recombinant Ycf4 be produced and purified for experimental use?

Production and purification of recombinant Ycf4 typically involves the following steps:

  • Cloning: The full-length ycf4 gene from C. reinhardtii is amplified and cloned into an appropriate expression vector. The gene sequence encoding the 197 amino acids of Ycf4 can be obtained from various databases or amplified directly from chloroplast DNA .

  • Expression Systems: For antibody production, E. coli expression systems have been successfully used to generate recombinant Ycf4 . The resulting protein can be used as an immunogen for antibody production or for structural studies.

  • Tagging Strategies: For in vivo studies of Ycf4 interactions, tandem affinity purification (TAP) tagging has proven effective. This approach involves fusing a TAP tag to the Ycf4 protein, allowing for subsequent purification of Ycf4-containing complexes under native conditions .

  • Verification: The integrity and functionality of recombinant Ycf4 can be verified through immunoblotting using anti-Ycf4 antibodies. When TAP-tagged, the size increase from 22 kDa (native) to approximately 44 kDa (tagged) can be observed .

  • Functional Assessment: For TAP-tagged variants, functionality is confirmed by assessing the ability of transformed cells to grow photoautotrophically and maintain normal PSI activity .

What techniques are employed to study Ycf4-containing complexes?

Researchers use several sophisticated techniques to study Ycf4-containing complexes:

  • Tandem Affinity Purification (TAP): This method has been successfully used to isolate stable Ycf4-containing complexes exceeding 1500 kDa. The technique involves creating a TAP-tagged Ycf4 fusion protein, allowing for two-step purification under native conditions that preserves protein-protein interactions .

  • Sucrose Gradient Ultracentrifugation: This technique separates protein complexes based on size and density, allowing for the isolation of intact Ycf4 complexes. When combined with ion exchange column chromatography, it has revealed the co-purification of Ycf4 with COP2, indicating their intimate association .

  • Mass Spectrometry: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been employed to identify the components of purified Ycf4 complexes, revealing the presence of PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and COP2 .

  • Immunoblotting: Western blot analysis with specific antibodies confirms the presence of Ycf4 and its associated proteins in purified complexes .

  • Transmission Electron Microscopy (TEM): This technique has been used to visualize purified Ycf4 complexes, revealing particles measuring approximately 285 × 185 Å and providing insights into their oligomeric structure .

  • Pulse-chase Protein Labeling: This method has demonstrated that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, supporting the role of Ycf4 as a scaffold for PSI assembly .

What is the precise role of Ycf4 in PSI assembly?

Based on current research, Ycf4's role in PSI assembly appears to be multifaceted:

  • Assembly Platform: Ycf4 forms a large complex (>1500 kDa) that serves as a scaffold or assembly platform for PSI components. Pulse-chase protein labeling experiments have shown that newly synthesized PSI polypeptides associate with this Ycf4 complex as they begin to assemble .

  • Mediator of Protein Interactions: Ycf4 likely facilitates interactions between different PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) during the assembly process. The co-purification of these subunits with Ycf4 complexes supports this role .

  • Post-translational Processing: Evidence suggests that Ycf4 functions primarily at the post-translational level rather than affecting the expression of PSI genes. Ycf4 and Ycf3 are not essential for PSI subunit synthesis but are involved in the assembly or stability of the PSI complex .

  • Stabilization of Assembly Intermediates: The presence of partially assembled, pigment-containing subcomplexes in purified Ycf4 preparations suggests that Ycf4 may help stabilize PSI assembly intermediates before they are integrated into the complete PSI complex .

  • Domain-specific Functions: Recent research comparing full versus partial knockouts indicates that different regions of Ycf4, particularly the C-terminal domain, may have specific interactions with other chloroplast proteins involved in PSI assembly .

How does the absence of Ycf4 affect chloroplast ultrastructure?

Transmission electron microscopy (TEM) studies of Ycf4 knockout plants have revealed significant ultrastructural changes in chloroplasts:

These observations suggest that Ycf4 plays a critical role in maintaining proper chloroplast ultrastructure, likely through its function in PSI assembly, which is essential for the normal development and organization of thylakoid membranes.

What explains the conflicting findings regarding the essentiality of Ycf4 in different studies?

The discrepancies in research findings regarding Ycf4 essentiality can be attributed to several factors:

  • Extent of Gene Disruption: A critical factor appears to be whether studies performed complete or partial knockout of the Ycf4 gene. In tobacco, studies that removed only 93 of 184 amino acids from the N-terminus reported that Ycf4 was non-essential, while complete knockout of all 184 amino acids resulted in plants that failed to grow autotrophically .

  • C-terminal Functionality: In-silico protein-protein interaction studies suggest that the C-terminal region (91 amino acids) of Ycf4 interacts with other chloroplast proteins. Partial knockouts that preserved this region may have retained some functional capacity .

  • Organism-specific Differences: The requirement for Ycf4 varies across photosynthetic organisms. In C. reinhardtii, Ycf4 is absolutely essential for PSI accumulation and photoautotrophic growth . In contrast, cyanobacterial mutants lacking the Ycf4 homolog (Orf184) can still assemble PSI, albeit at reduced levels .

  • Experimental Conditions: Growth conditions, including light intensity and nutrient availability, may influence the observed phenotypes of Ycf4 mutants. For example, some mutants may exhibit conditional lethality depending on light conditions or carbon source availability .

  • Compensatory Mechanisms: Some organisms may possess alternative or redundant assembly pathways that can partially compensate for Ycf4 absence, particularly under certain growth conditions or when partial Ycf4 function is retained .

What proteins interact with Ycf4 and how do these interactions contribute to PSI assembly?

Ycf4 forms an intricate network of protein interactions that facilitate PSI assembly:

These interactions collectively support Ycf4's role as a molecular scaffold that coordinates the early stages of PSI assembly by bringing together newly synthesized components and facilitating their correct arrangement into functional subcomplexes.

What is known about the large Ycf4-containing complex and its structure?

The Ycf4-containing complex represents a massive molecular assembly with the following characteristics:

  • Size and Composition: The complex exceeds 1500 kDa, suggesting it comprises multiple protein components beyond Ycf4 itself. Mass spectrometry has identified COP2 and several PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) as constituents of this complex .

  • Physical Dimensions: Electron microscopy has revealed that the largest structures in purified Ycf4 complex preparations measure approximately 285 × 185 Å. These dimensions are consistent with a large multi-protein assembly capable of accommodating PSI components during assembly .

  • Oligomeric States: Electron microscopy suggests that the Ycf4 complex may exist in several large oligomeric states, though the exact stoichiometry remains to be determined .

  • Stability and Interactions: The complex shows remarkable stability during purification procedures, including tandem affinity purification, sucrose gradient ultracentrifugation, and ion exchange chromatography. The COP2 protein appears to contribute to this stability, as reduced COP2 levels increase the salt sensitivity of the complex .

  • Functional State: Pulse-chase protein labeling experiments indicate that the PSI polypeptides associated with the Ycf4 complex are newly synthesized and partially assembled as pigment-containing subcomplexes. This suggests the complex represents an active assembly intermediate rather than a storage form .

While significant progress has been made in characterizing this complex, higher-resolution structural studies, such as cryo-electron microscopy or X-ray crystallography, could provide more detailed insights into the spatial arrangement of components and the mechanism of PSI assembly.

What is the significance of the COP2 protein in the Ycf4 complex?

The opsin-related COP2 protein has emerged as an intriguing component of the Ycf4 complex with the following characteristics and potential functions:

  • Exclusive Association: Almost all Ycf4 and COP2 in wild-type cells co-purify during sucrose gradient ultracentrifugation and ion exchange chromatography, indicating their intimate and exclusive association .

  • Complex Stability: Experimental reduction of COP2 to approximately 10% of wild-type levels using RNA interference increased the salt sensitivity of the Ycf4 complex, suggesting that COP2 contributes to the structural stability of the assembly .

  • Non-essential Role in PSI Assembly: Despite its close association with Ycf4, reduced COP2 levels did not affect the accumulation of PSI, indicating that COP2 is not essential for the primary function of Ycf4 in PSI assembly .

  • Potential Regulatory Function: As an opsin-related protein, COP2 may have light-sensing capabilities that could potentially modulate Ycf4 activity or complex stability in response to changing light conditions, though this remains speculative .

  • Evolutionary Implications: The association between a photosystem assembly factor (Ycf4) and an opsin-related protein (COP2) raises interesting questions about potential evolutionary connections between different light-responsive systems in photosynthetic organisms .

The exact mechanistic role of COP2 in the Ycf4 complex remains an open question for future research, particularly regarding whether it has any direct involvement in the PSI assembly process beyond providing structural stability to the complex.

How does understanding Ycf4 function contribute to broader knowledge of photosystem assembly?

Research on Ycf4 has provided several key insights into photosystem assembly:

  • Assembly Factor Paradigm: Ycf4 exemplifies a class of proteins that are essential for photosystem assembly but are not components of the final complex. This supports the concept that complex photosynthetic structures require dedicated assembly machinery beyond their structural subunits .

  • Species-specific Assembly Mechanisms: The varying importance of Ycf4 across different photosynthetic organisms (essential in C. reinhardtii and tobacco, less critical in cyanobacteria) reveals evolutionary divergence in photosystem assembly pathways, suggesting that different organisms have developed specialized or redundant mechanisms for this process .

  • Temporal Coordination: The association of newly synthesized PSI components with Ycf4 complexes indicates that assembly factors play key roles in the temporal coordination of photosystem biogenesis, potentially ensuring that components are assembled in the correct order .

  • Chloroplast Ultrastructure Development: The profound effects of Ycf4 deletion on chloroplast morphology and thylakoid membrane organization demonstrate the intimate connection between photosystem assembly and the development of chloroplast ultrastructure .

  • Post-translational Regulation: The evidence that Ycf4 functions primarily at the post-translational level highlights the importance of protein-protein interactions and complex formation in regulating photosynthetic capacity beyond gene expression .

These insights contribute to our fundamental understanding of how complex photosynthetic machinery is assembled and maintained, with potential implications for efforts to engineer improved photosynthetic efficiency in crops or biofuel-producing organisms.

What methodological approaches from Ycf4 studies can be applied to investigate other photosynthetic proteins?

The study of Ycf4 has pioneered several powerful methodological approaches that can be applied to other photosynthetic proteins:

  • TAP Tagging for Native Complex Isolation: The successful use of tandem affinity purification (TAP) tagging to isolate intact Ycf4-containing complexes demonstrates the value of this approach for studying native protein assemblies without disrupting their structure or function . This technique can be adapted to investigate other photosynthetic protein complexes.

  • Complementary Knockout Strategies: The comparison of complete versus partial gene knockouts of Ycf4 revealed important functional domains and resolved conflicting reports about its essentiality . This approach of creating different knockout variants could help clarify the function of other photosynthetic proteins with multiple domains.

  • Pulse-chase Analysis of Assembly Intermediates: The use of pulse-chase protein labeling to demonstrate that PSI polypeptides associated with Ycf4 are newly synthesized provides a powerful tool for distinguishing assembly intermediates from stable complexes . This technique could reveal the assembly pathways of other photosynthetic complexes.

  • Integrated Structural and Functional Analysis: The combination of electron microscopy, protein biochemistry, and physiological measurements used in Ycf4 studies provides a comprehensive approach to connecting protein structure with function . This multi-disciplinary strategy could be valuable for understanding other photosynthetic components.

  • RNA Interference for Dose-dependent Analysis: The use of RNA interference to reduce COP2 levels to 10% of wild-type revealed subtle roles in complex stability that might have been missed in complete knockout studies . This approach could uncover dose-dependent functions of other photosynthetic proteins.

These methodological innovations represent valuable tools for investigating the complex machinery of photosynthesis, potentially accelerating discoveries about how these sophisticated molecular assemblies function and evolve.

What are the most promising future research directions for Ycf4 studies?

Several promising research directions could advance our understanding of Ycf4 and its role in photosynthesis:

  • High-resolution Structural Studies: Applying cryo-electron microscopy or X-ray crystallography to determine the atomic structure of the Ycf4 complex would provide unprecedented insights into how this assembly factor coordinates PSI components during assembly .

  • Dynamic Assembly Analysis: Developing methods to visualize the PSI assembly process in real-time, potentially using fluorescently tagged components and advanced microscopy, could reveal the temporal sequence and dynamics of Ycf4-mediated assembly .

  • Domain-specific Mutagenesis: Creating targeted mutations in specific domains of Ycf4, particularly the C-terminal region implicated in protein interactions, could identify critical residues for function and provide a more nuanced understanding of how different parts of the protein contribute to PSI assembly .

  • Comparative Genomics and Evolution: Expanding the analysis of Ycf4 across a broader range of photosynthetic organisms could reveal how this assembly factor has evolved and potentially identify organisms with alternative assembly mechanisms that could inform synthetic biology approaches .

  • COP2-Ycf4 Interaction Mechanism: Investigating the molecular basis and functional significance of the tight association between Ycf4 and the opsin-related COP2 protein could reveal novel regulatory mechanisms linking light perception to photosystem assembly .

  • Applied Bioengineering: Exploring whether modifications to Ycf4 or its expression levels could enhance photosystem assembly efficiency, potentially leading to improved photosynthetic capacity in agricultural crops or biofuel-producing organisms .

These research directions hold promise for both fundamental advances in our understanding of photosynthesis and potential applications in addressing global challenges related to food security and sustainable energy production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.