Recombinant Chlamydomonas reinhardtii Photosystem I reaction center subunit VI, chloroplastic (PSAH)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosynthesis

PSAH plays dual roles in PSI dynamics:

RoleMechanismSource
LHCI DockingMediates binding of LHCI to PSI core via interactions with Lhca subunits (e.g., Lhca9) .
State TransitionsRegulates thylakoid membrane organization during light adaptation .

Key Findings:

  • Absence of PSAH alters PSI dimerization, shifting from head-to-head to head-to-tail orientations .

  • PSAH-deficient mutants show impaired LHCI integration, reducing light-harvesting efficiency .

Recombinant Production and Applications

Recombinant PSAH is produced via heterologous systems, primarily for structural and functional studies:

Production Strategies

SystemHostTagYieldPurityReferences
E. coliBacterialN-terminal HisLyophilized powder≥85% (SDS-PAGE)
ChloroplastC. reinhardtiiNativeUp to 10% TSP (transgenic)High (soluble)

Applications:

  • Structural Biology: Used in cryo-EM studies to resolve PSI-LHCI supercomplexes at 2.3 Å resolution .

  • Antibody Development: Recombinant PSAH serves as an immunogen for polyclonal antibodies (e.g., rabbit anti-PSAH) .

Comparative Analysis with Other PSI Subunits

Below is a comparison of PSAH with core and peripheral PSI subunits:

SubunitFunctionMolecular WeightLocalizationKey References
PsaA/BCore subunits; bind P700 and iron-sulfur clusters~83 kDaPSI core
PsaHLHCI docking, state transitions14.15 kDaPeriphery (thylakoid lumen)
Lhca9Mediates PSI dimerization~25 kDaLHCI antennae

Research Challenges and Future Directions

  • Production Optimization: Enhancing yield in C. reinhardtii chloroplasts requires balancing photosynthetic competency and transgene expression .

  • Functional Studies: Elucidating PSAH’s precise role in membrane remodeling during state transitions remains critical .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
PSAH; Photosystem I reaction center subunit VI, chloroplastic; PSI-H; Light-harvesting complex I 11 kDa protein; P28 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-130
Protein Length
full length protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
PSAH
Target Protein Sequence
KYGENSRYFDLQDMENTTGSWDMYGVDEKKRYPDNQAKFFTQATDIISRRESLRALVALS GIAAIVTYGLKGAKDADLPITKGPQTTGENGKGGSVRSRL
Uniprot No.

Target Background

Function
This protein may play a role in the docking of the LHC I antenna complex to the core complex.
Database Links
Protein Families
PsaH family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the role of PSAH in photosystem architecture?

PSAH (Photosystem I reaction center subunit VI, chloroplastic) is a crucial component of the photosynthetic apparatus in Chlamydomonas reinhardtii. It functions primarily as a regulatory subunit that prevents PSI oligomerisation, which represents a significant evolutionary adaptation in eukaryotic photosynthetic organisms . PSAH is composed of one transmembrane helix and one membrane parallel helix that physically restricts the association of neighboring PsaL subunits . This structural arrangement prevents the formation of PSI trimers that are commonly observed in cyanobacteria, which lack the PsaH subunit .

The subunit works in concert with PsaL and PsaO to regulate the association of LHCII (Light-Harvesting Complex II) to PSI during state transitions, which is a critical adaptation mechanism for optimizing photosynthetic efficiency under varying light conditions . The strategic positioning of PSAH, sandwiched between PsaL and PsaB in all solved structures of PSI, underscores its functional significance in maintaining the monomeric organization of eukaryotic PSI complexes.

How does PSAH differ structurally and functionally from its cyanobacterial ancestors?

PSAH represents an evolutionary innovation in eukaryotic photosynthetic organisms that is absent in cyanobacteria . This structural difference correlates directly with the oligomerization state of Photosystem I (PSI) across evolution. In cyanobacteria, PSI typically forms trimers through interactions between PsaL subunits from adjacent monomers . The emergence of PSAH in eukaryotes introduced a physical barrier that prevents these PsaL-mediated interactions, resulting in exclusively monomeric PSI complexes in algae and higher plants .

Functionally, PSAH's role has evolved beyond simply preventing oligomerization. In eukaryotic photosynthetic organisms, PSAH works together with PsaL and PsaO to coordinate state transitions - a regulatory mechanism that balances excitation energy between PSI and PSII by facilitating the association of LHCII with PSI under certain light conditions . This functional adaptation demonstrates how the acquisition of PSAH contributed to the enhanced flexibility of the photosynthetic apparatus in response to changing environmental conditions.

How does PSAH contribute to the electrostatic landscape of Photosystem I?

PSAH's positioning influences this water network arrangement, which dates back evolutionarily to cyanobacteria . This conserved network is particularly important in the vicinity of the electron transport chain, where subtle electrostatic changes can significantly impact electron transfer efficiency. The water molecules also serve as ligands for chlorophylls that lack a fifth magnesium coordination in both the PSI core and associated light-harvesting complexes . This arrangement fine-tunes the redox potential gradients necessary for efficient directional electron flow through the photosystem.

What structural insights have been gained from high-resolution studies of PSI complexes containing PSAH?

Recent high-resolution structural studies of PSI from the temperature-sensitive photoautotrophic PSII mutant (TSP4) of Chlamydomonas reinhardtii have provided unprecedented insights into the organization of PSI-LHCI supercomplexes. Structures solved by cryo-electron microscopy at resolutions of 2.54 Å (TSP4-10LHC) and 3.15 Å (TSP4-8LHC) have revealed detailed molecular interactions within these complexes .

These high-resolution structures have uncovered a conserved network of water molecules that extends from the core PSI complex through to the light-harvesting antenna system . The structures also provided the first observation of eukaryotic PSI oligomerization through a low-resolution PSI dimer that was comprised of PSI-10LHC and PSI-8LHC variants . This finding challenges previous assumptions about the exclusively monomeric nature of eukaryotic PSI and suggests potential functional significance to the dimeric arrangement under specific physiological conditions.

The detailed structural information from these studies also clarifies how PSAH coordinates with other PSI subunits, particularly PsaL and PsaB, to establish the characteristic architecture of the eukaryotic photosystem .

What are the experimental challenges in expressing and purifying functional recombinant PSAH?

Expressing and purifying functional recombinant PSAH presents several experimental challenges that researchers must address:

  • Inclusion body formation: When expressed in E. coli, recombinant PSAH often accumulates in inclusion bodies, necessitating solubilization and refolding steps that can compromise final protein yield and activity .

  • Proper folding: As a membrane protein with both transmembrane and membrane-parallel helices, PSAH requires specific conditions to achieve its native conformation. The protein must be carefully refolded in the presence of appropriate detergents or lipid environments to maintain its structural integrity .

  • Post-translational modifications: While bacterial expression systems like E. coli are convenient for protein production, they lack the post-translational modification machinery present in eukaryotic cells, potentially affecting the functionality of the recombinant protein .

  • Protein stability: Purified PSAH is prone to aggregation and denaturation, requiring careful optimization of buffer conditions, including pH, ionic strength, and the presence of stabilizing agents like trehalose (6% is commonly used in storage buffers) .

  • Functional assays: Verifying the functionality of isolated PSAH is challenging since its natural role is embedded within the larger PSI complex. Researchers must develop reliable assays to verify that the recombinant protein retains its native binding properties and structural characteristics .

To address these challenges, researchers typically employ specialized approaches including sequential purification steps, careful refolding protocols, and rigorous quality control measures to ensure the biological relevance of the purified protein .

What is the optimal expression system for producing recombinant PSAH?

Based on current research methodologies, Escherichia coli represents the most commonly utilized expression system for producing recombinant PSAH . While eukaryotic expression systems might theoretically provide advantages for post-translational modifications, the relatively simple structure of PSAH makes bacterial expression a practical and efficient choice. The optimal expression protocol involves several key considerations:

  • Vector selection: Expression vectors containing strong, inducible promoters (such as T7) with appropriate fusion tags (commonly His-tag) facilitate both expression control and subsequent purification .

  • E. coli strain: BL21(DE3) or its derivatives are typically preferred due to their reduced protease activity and efficient protein production capabilities .

  • Growth conditions: Culture at 37°C until reaching OD600 of 0.6-0.8, followed by induction with IPTG at reduced temperatures (16-25°C) to slow protein synthesis and promote proper folding .

  • Induction parameters: Lower IPTG concentrations (0.1-0.5 mM) and extended expression periods (overnight) at reduced temperatures often yield better results than high-concentration, short-duration expressions .

  • Media composition: Enriched media such as Terrific Broth or auto-induction media can enhance protein yield while minimizing the need for constant monitoring .

This approach typically results in the accumulation of PSAH in inclusion bodies, necessitating subsequent solubilization and refolding steps to obtain functional protein .

What purification strategy yields the highest purity and activity of recombinant PSAH?

A multi-step purification strategy is required to obtain high-purity, functional recombinant PSAH with preserved structural integrity. The following optimized protocol demonstrates consistently superior results:

  • Inclusion body isolation: After cell lysis (typically using sonication or high-pressure homogenization), inclusion bodies containing PSAH are collected by centrifugation and washed with detergent-containing buffers to remove cell debris and contaminating proteins .

  • Solubilization: Inclusion bodies are solubilized using denaturing agents such as 8M urea or 6M guanidine hydrochloride in Tris-based buffers (pH 8.0) .

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin captures the His-tagged PSAH under denaturing conditions .

  • Refolding: On-column or dilution refolding is performed by gradually removing the denaturing agent while introducing stabilizing additives like trehalose (6%) and appropriate detergents .

  • Secondary purification: Size exclusion chromatography separates properly folded monomeric PSAH from aggregates and remaining impurities .

  • Quality control: SDS-PAGE analysis typically confirms purity exceeding 90%, while circular dichroism spectroscopy can verify proper secondary structure formation .

For long-term storage, the purified protein is lyophilized or stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0, typically at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles .

How can researchers verify the structural integrity and functionality of purified recombinant PSAH?

Verifying both the structural integrity and functionality of purified recombinant PSAH requires a multi-faceted analytical approach:

Structural Verification Methods:

  • Circular Dichroism (CD) Spectroscopy: CD analysis in the far-UV range (190-260 nm) provides information about secondary structure content, confirming the expected α-helical signature characteristic of PSAH .

  • Thermal Shift Assays: Differential scanning fluorimetry can assess the thermal stability of the purified protein, providing insight into proper folding and stability in various buffer conditions .

  • Limited Proteolysis: Controlled proteolytic digestion followed by mass spectrometry analysis can confirm the expected structural domains and proper folding of the protein .

Functional Verification Methods:

  • Binding Assays: Surface plasmon resonance or isothermal titration calorimetry can measure PSAH's ability to interact with other PSI components, particularly PsaL and PsaB .

  • Reconstitution Experiments: Integration of purified PSAH into PSAH-depleted PSI complexes should restore specific functional characteristics, which can be measured through spectroscopic methods .

  • State Transition Analysis: When introduced to appropriate membrane systems, functional PSAH should demonstrate its role in facilitating state transitions, measurable through fluorescence quenching assays .

The combination of these analytical approaches provides comprehensive verification that the recombinant PSAH maintains both its structural integrity and functional capabilities, ensuring its suitability for subsequent experimental applications.

How should researchers interpret differences in experimental results between native and recombinant PSAH?

When comparing experimental results between native and recombinant PSAH, researchers should consider several key factors that might contribute to observed differences:

  • Post-translational modifications: Native PSAH may undergo specific modifications in Chlamydomonas reinhardtii that are absent in recombinant protein expressed in bacterial systems. These differences can affect protein-protein interactions, stability, and functionality .

  • Lipid environment: Native PSAH functions within the thylakoid membrane's specific lipid composition, which is difficult to replicate in recombinant systems. The absence of this native environment may alter the protein's conformational dynamics .

  • Protein-protein context: In vivo, PSAH exists in a complex network of interactions with other PSI subunits and light-harvesting complexes. Recombinant PSAH studied in isolation lacks these stabilizing interactions .

  • Tag interference: His-tags or other fusion elements used for purification may sterically hinder interactions or alter the protein's electrostatic properties, particularly if they are not cleaved prior to functional studies .

When interpreting differences, researchers should implement appropriate controls, including parallel experiments with native PSI complexes when possible, and consider complementary approaches such as computational modeling to bridge the gap between recombinant and native protein behaviors.

What statistical approaches are most appropriate for analyzing PSAH functional assay data?

When analyzing functional assay data for recombinant PSAH, researchers should employ statistical approaches that adequately account for the variability inherent in biological systems and the specific characteristics of photosynthetic protein assays:

  • Replicate design: A minimum of three biological replicates (independent protein preparations) and three technical replicates (repeated measurements) should be used to establish statistical robustness .

  • Normalization procedures: Data should be normalized to appropriate controls, such as wild-type PSI activity or reference proteins, to account for day-to-day variations in experimental conditions .

  • Statistical tests: For comparing multiple experimental conditions:

    • Analysis of Variance (ANOVA) followed by post-hoc tests (such as Tukey's HSD) for parametric data

    • Kruskal-Wallis test followed by Dunn's test for non-parametric data

    • False Discovery Rate (FDR) correction should be applied when performing multiple comparisons

  • Regression analysis: For dose-response relationships or time-course studies, nonlinear regression models should be applied, with careful consideration of appropriate equation selection (e.g., Hill equation for binding studies) .

  • Variance analysis: Mixed-effects models can be particularly valuable when accounting for both fixed effects (experimental conditions) and random effects (batch-to-batch variation in protein preparations) .

For all statistical analyses, researchers should report effect sizes along with p-values to provide a complete picture of both statistical and biological significance.

How can structural knowledge of PSAH inform the engineering of improved photosynthetic efficiency?

Detailed structural knowledge of PSAH provides several avenues for engineering enhanced photosynthetic efficiency:

These engineering approaches could have significant implications for improving bioenergy production in algal systems and enhancing crop productivity through improved photosynthetic efficiency.

What are the current methodological gaps in studying PSAH-dependent processes?

Despite significant advances in our understanding of PSAH, several methodological gaps continue to hamper comprehensive study of PSAH-dependent processes:

  • Temporal resolution limitations: Current techniques provide static snapshots of PSI structures, but PSAH's role in dynamic processes like state transitions requires methods capable of capturing structural changes in real-time, at physiologically relevant timescales .

  • In vivo measurement challenges: While in vitro studies with purified components provide valuable insights, techniques for non-invasive monitoring of PSAH function within living cells remain limited, creating a gap between biochemical findings and physiological relevance .

  • Heterologous expression systems: Current bacterial expression systems fail to recapitulate the native chloroplast environment, potentially missing critical factors that influence PSAH folding and function. Improved chloroplast-mimetic expression systems would address this limitation .

  • Structure-function relationship tools: While high-resolution structures are available, methods to systematically probe how specific structural elements contribute to function (e.g., site-directed mutagenesis combined with in vivo functional assays) remain technically challenging in the context of the complex PSI architecture .

  • Integration of multi-scale data: Connecting molecular-level structural information with cellular and organism-level phenotypes requires improved computational frameworks and multi-scale modeling approaches that can bridge these different levels of biological organization .

Addressing these methodological gaps would significantly advance our understanding of PSAH's contribution to photosynthetic regulation and efficiency.

How might PSAH research contribute to synthetic biology applications?

PSAH research has several promising applications in synthetic biology:

  • Minimal photosynthetic units: Understanding the essential structural and functional role of PSAH could inform the design of minimalist artificial photosystems that retain high efficiency while reducing genetic complexity .

  • Biosensors: The sensitivity of PSAH-mediated processes to various environmental conditions (light quality, redox state) suggests potential applications in developing whole-cell biosensors for environmental monitoring or metabolic engineering .

  • Biohybrid energy systems: Recombinant PSAH could be incorporated into biohybrid devices that combine biological light-harvesting components with synthetic catalysts for solar energy conversion and storage .

  • Orthogonal photosynthetic systems: Knowledge of PSAH's evolutionary innovations could guide the development of orthogonal photosynthetic pathways in non-photosynthetic organisms, expanding the toolkit for synthetic biology applications .

  • Directed evolution platforms: PSAH's role in photosynthetic regulation makes it an attractive target for directed evolution approaches aimed at enhancing photosynthetic efficiency under specific environmental conditions or industrial processes .

These synthetic biology applications represent promising directions for translating fundamental PSAH research into biotechnological innovations with potential impacts in renewable energy, agriculture, and environmental monitoring.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.