Recombinant Chlamydomonas reinhardtii Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

CP47 is a chloroplast-encoded protein integral to Photosystem II (PSII) assembly. Key features include:

  • Gene locus: Encoded by the psbB gene within the chloroplast genome .

  • Structure: A transmembrane protein with six helical domains, coordinating chlorophyll a molecules for light harvesting .

  • Role: Acts as a core antenna, transferring energy to the PSII reaction center (D1/D2 heterodimer) and stabilizing the oxygen-evolving complex .

Key Mutant Phenotypes:

  • ΔpsbB mutants fail to accumulate PSII core proteins, leading to photoautotrophic growth defects .

  • psbH deletion destabilizes PSII core proteins, impairing dimerization .

Recombinant Production Methods

C. reinhardtii chloroplasts are engineered for recombinant CP47 production using:

  • Expression Vectors:

    • psbA promoter/UTR systems for high-yield expression (2–3% of total soluble protein) .

    • Fusion tags (e.g., His-tag) for purification .

  • Transformation: Particle bombardment integrates genes via homologous recombination .

Table 2: Recombinant CP47 Expression Systems

SystemYield (% TSP)TagLocalizationReference
C. reinhardtii chloroplast2–3%His-tagThylakoid membrane
E. coli (Spinach homolog)>90% purityHis-tagSoluble fraction

Functional Studies and Applications

  • Mutagenesis: Truncated psbB variants (e.g., +165 stop codon) reveal translational feedback mechanisms. Unassembled CP47 suppresses psbB mRNA translation, indicating a CES (Control by Epistasy of Synthesis) regulatory mechanism .

  • Biotechnological Potential:

    • C. reinhardtii chloroplasts are leveraged for scalable CP47 production, aiding photosynthesis research .

    • Recombinant CP47 enables studies on chlorophyll-protein interactions and PSII repair cycles .

Challenges and Future Directions

  • Stability Issues: Unassembled CP47 degrades rapidly unless stabilized by chaperones like Alb3.1 .

  • Heterologous Expression: While E. coli systems achieve high purity , chloroplast-based production better retains native post-translational modifications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGSMALFEISVFDPSDPVLNPMWRQGM FVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIILSGALFLASVWHWTYWDL ELFRDPRTGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGRVQP VAPSWGADGFDPYNPGGIASHHIAAGILGVLAGLFHLCVRPSIRLYFGLSMGSIETVLSS SIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSD AWSRIPEKLAFYDYIGNNPAKGGLFRTGAMNSGDGIAVGWLGHASFKDQEGRELFVRRMP TFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDPATVKKY ARKAQLGEIFEFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFA GIDDDINDQVEFGKYKKLGDTSSLREAF
Uniprot No.

Target Background

Function
CP47, also known as Photosystem II CP47 chlorophyll apoprotein (psbB), is a crucial component of the core complex of photosystem II (PSII). It binds chlorophyll and plays a key role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from water, generating oxygen and a proton gradient that subsequently drives ATP formation.
Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 chlorophyll apoprotein (psbB) in Photosystem II of Chlamydomonas reinhardtii?

CP47 is one of the integral antenna complexes of the oxygen-evolving Photosystem II (PSII) that plays a critical role in efficient excitation energy transfer to the PSII reaction center. It contains 16 chlorophyll molecules whose arrangement and electronic properties are essential for its light-harvesting function. The charge-transfer excitation induced among coupled reaction center chromophores ultimately resolves into charge separation, initiating the electron transfer cascade that drives oxygenic photosynthesis. The psbB gene encodes this chlorophyll apoprotein, and understanding its structure-function relationship is fundamental to photosynthesis research.

How does the structure of CP47 contribute to its function in photosynthesis?

The CP47 antenna complex contains 16 chlorophyll molecules arranged in a specific spatial configuration that facilitates efficient light harvesting and energy transfer. This arrangement creates an energy transfer pathway directing excitation energy toward the reaction center. The site energies of these chlorophylls (their excitation energies) determine the directionality and kinetics of energy transfer. Recent quantum mechanics/molecular mechanics (QM/MM) approaches have demonstrated that the most red-shifted chlorophylls in CP47 are B3 followed by B1, contrary to previous hypotheses in the literature. This finding provides new insights into the energy transfer pathways within CP47.

The protein environment around each chlorophyll molecule tunes its excitation energy through electrostatic interactions. These protein-pigment interactions are critical for optimizing the efficiency of light harvesting and energy transfer to the reaction center. Understanding these structural features is essential for both basic research and potential applications in artificial photosynthesis.

What are the different nomenclatures used for CP47 chlorophylls in scientific literature?

Multiple nomenclature systems have been developed for the chlorophylls in CP47, which can create confusion when comparing results across different studies. The nomenclature proposed by Müh and Zouni is one recently adopted system referenced in the literature. When working with CP47, researchers should clearly specify which nomenclature system they are using and provide cross-references to other systems when possible to facilitate comparison with previous studies.

The variation in nomenclature reflects the evolution of structural knowledge about CP47 and highlights the importance of standardization in scientific communication. When publishing research on CP47, it is advisable to include a reference figure labeling the chlorophylls according to the chosen nomenclature system and noting alternative labels used in other major publications.

What expression systems are most effective for recombinant CP47 production in Chlamydomonas reinhardtii?

For recombinant protein production in Chlamydomonas reinhardtii chloroplasts, several promoter and untranslated region (UTR) combinations have been evaluated. The psbA promoter/5' UTR has demonstrated high levels of heterologous protein accumulation but is effective only in psbA-deficient genetic backgrounds due to psbA/D1-dependent auto-attenuation. This limitation presents a significant challenge when photosynthetic competence is required.

Research has shown that fusion of the strong 16S rRNA promoter to the 5' UTR of specific genes can enhance transgene expression. While fusion of the 16S promoter to the psbA 5' UTR had minimal impact on protein accumulation in a psbA-deficient background and was silenced in the presence of wild-type D1 protein, fusion of the 16S promoter to the atpA 5' UTR significantly boosted mRNA levels and supported high levels of heterologous protein accumulation in photosynthetic-competent cells.

The 16S/atpA promoter/UTR combination drove LUXCT protein accumulation to levels close to that achieved with psbA in a psbA-deficient background, and drove expression of a human therapeutic protein to levels only twofold lower than the psbA 5' UTR. This combination is particularly valuable for heterologous protein production when expression from a photosynthetic-competent microalgal strain is required.

How do researchers determine chlorophyll site energies in CP47, and why are there conflicting results?

Advanced computational approaches now provide new insights. Multiscale quantum mechanics/molecular mechanics (QM/MM) using time-dependent density functional theory with modern range-separated functionals has enabled computation of excitation energies for all CP47 chlorophylls in complete membrane-embedded cyanobacterial PSII dimers. This approach quantifies the electrostatic effect of the protein on chlorophyll site energies within a "near-native" computational model.

These computational studies have identified chlorophyll B3, followed by B1, as the most red-shifted chlorophylls, contradicting some previous hypotheses. Chlorophyll B7, with the third lowest site energy, is also a candidate for a red chlorophyll. The conflicts in the literature likely stem from variations in experimental samples, preparation methods, and interpretations of spectroscopic data.

How does the isolation of CP47 affect its structural stability compared to its PSII-associated form?

Many experimental studies on CP47 and other light-harvesting complexes utilize extracted samples, raising questions about structural integrity after isolation. Molecular dynamics simulations of isolated CP47 compared to its PSII-embedded form can identify which regions become structurally destabilized upon isolation.

The structural changes that occur upon isolation may affect the protein-chlorophyll interactions that determine site energies and energy transfer properties. This is a likely explanation for the variability observed in different experimental datasets. Some studies suggest that certain chlorophylls may be lost under particular treatment conditions, further complicating the interpretation of results from isolated CP47 preparations.

Researchers should be aware of these potential structural changes when designing experiments with isolated CP47 and consider complementary approaches, such as computational modeling of the complete PSII-embedded complex, to provide context for interpreting experimental results from isolated samples.

What quantum mechanical methods are most appropriate for computing chlorophyll excitation energies in CP47?

Computing accurate chlorophyll excitation energies requires sophisticated quantum mechanical methods. For CP47 research, multiscale quantum mechanics/molecular mechanics (QM/MM) approaches utilizing full time-dependent density functional theory with modern range-separated functionals have proven effective. This methodology allows for computing the excitation energies of all CP47 chlorophylls within a complete membrane-embedded cyanobacterial PSII dimer.

The computational results can be validated against spectroscopic measurements, though direct comparison may be complicated by experimental variations. Researchers should consider both experimental and computational approaches as complementary methods for understanding the electronic properties of CP47 chlorophylls.

What are the key challenges in maintaining native chlorophyll binding in recombinant CP47?

Producing recombinant CP47 with its full complement of correctly bound chlorophylls presents significant challenges. The complex regulatory network that tightly controls chloroplast gene expression in Chlamydomonas reinhardtii means that heterologous protein accumulation in wild-type, photosynthetic-competent algal chloroplast typically remains low.

For CP47 specifically, ensuring proper folding and assembly with all 16 chlorophyll molecules in their native positions requires careful consideration of expression conditions. The protein environment around each chlorophyll molecule is crucial for tuning its excitation energy through electrostatic interactions, and disruptions to this environment can alter the functional properties of the complex.

Researchers must balance expression levels with the capacity of the cell's chlorophyll biosynthesis and protein assembly machinery. Overexpression may lead to incomplete chlorophyll incorporation or misfolded protein. Strategic selection of promoter/UTR combinations, such as the 16S/atpA fusion described earlier, can help optimize expression while maintaining photosynthetic competence.

How can researchers address data inconsistencies in CP47 studies from different laboratories?

To address these inconsistencies, researchers should:

  • Carefully document and report all details of sample preparation and experimental conditions

  • Utilize multiple complementary techniques to characterize the same sample

  • Compare results from isolated CP47 with those from intact PSII complexes

  • Consider computational approaches to bridge gaps between different experimental datasets

  • Participate in inter-laboratory comparison studies to standardize methods

Computational approaches, such as the QM/MM methods described earlier, can provide a theoretical framework for interpreting and reconciling conflicting experimental results. By modeling CP47 in its native PSII-embedded environment, researchers can establish a reference point for understanding how different isolation and experimental procedures might affect the observed properties.

What advancements in expression systems could improve recombinant CP47 production?

Future improvements in recombinant CP47 production may come from further refinement of promoter/UTR combinations or the development of novel regulatory elements. The success of the 16S/atpA promoter/UTR fusion for heterologous protein expression suggests that similar approaches could be tailored specifically for CP47 production.

Genome editing technologies could be used to modify endogenous regulatory elements to enhance expression while maintaining the natural context of the gene. This approach might preserve the complex regulatory networks necessary for proper assembly of CP47 with its chlorophyll molecules while increasing protein yield.

Additionally, synthetic biology approaches could create optimized expression cassettes that balance transcription, translation, and post-translational processes to ensure both high expression and proper assembly of the CP47-chlorophyll complex. These advancements would benefit not only basic research on photosynthesis but also potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.