Recombinant Chlamydomonas reinhardtii Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Overview of Photosystem II in Chlamydomonas reinhardtii

Photosystem II is a complex in the thylakoid membranes of chloroplasts that is essential for oxygenic photosynthesis. It consists of several subunits, including the D1 protein, which contains the Q(B) binding site. Mutations in the D1 protein, such as those at position F265, have been studied to understand their effects on herbicide binding and electron transfer efficiency .

Components of Photosystem II Relevant to Q(B) Function

  • D1 Protein: This protein is crucial for the function of PSII, particularly in the Q(B) site. Mutations in the D1 protein can affect the binding of herbicides like atrazine and alter electron transfer rates .

  • CP43 (PsbC): While not directly involved in the Q(B) site, CP43 is a core component of PSII. Recombinant CP43 proteins have been produced for research purposes, such as studying PSII structure and function .

Recombinant Proteins in Research

Recombinant proteins are widely used in research to study the structure and function of photosynthetic complexes. For example, the recombinant full-length Chlamydomonas reinhardtii Photosystem II CP43 chlorophyll apoprotein (psbC) has been expressed in E. coli for such studies .

Research Findings on PSII Repair and Function

Recent studies have focused on the repair mechanisms of PSII, involving proteins like TEF14, PRF1, and PRF2, which facilitate the disassembly and reassembly of damaged PSII complexes . These processes are crucial for maintaining photosynthetic efficiency under stress conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Chlamydomonas reinhardtii (Chlamydomonas smithii)
Target Names
psbA
Target Protein Sequence
TAILERRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIITGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFLL GVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGFN FNQSVVDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function

This protein is one of two reaction center proteins within Photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H₂O, generating O₂ and a proton gradient utilized for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.

Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the QB binding site and why is it significant in Chlamydomonas reinhardtii?

The QB binding site in Photosystem II of C. reinhardtii is the pocket where the secondary quinone electron acceptor binds within the D1 protein. This site is crucial for the electron transport chain as it facilitates the transfer of electrons from QA to plastoquinone, which subsequently becomes reduced and protonated to form plastoquinol (PQH2). The significance of this site lies in its role as the interface between PSII and the plastoquinone pool, making it essential for photosynthetic electron flow and subsequent metabolic processes including hydrogen production .

How does electron transfer occur at the QB site in PSII?

Electron transfer at the QB site follows a sequential reduction process. After light excitation, electrons move from the reaction center through pheophytin to QA, and then to QB. The QB molecule requires two sequential electrons to become fully reduced:

  • First electron transfer: QB + e- → QB- - (semiquinone formation)

  • Second electron transfer + protonation: QB- - + e- + 2H+ → QBH2 (plastoquinol formation)

The energy gap between QA/QA- - and QB/QB- - couples provides the driving force for electron transfer from QA- - to QB. According to EPR measurements, this energy gap is approximately 234 meV, significantly larger than the previously accepted value of ~70 meV . This substantial driving force ensures efficient forward electron transfer while minimizing back-reactions.

The semiquinone intermediate (QB- -) is relatively stable, with a measured midpoint potential (Em) of approximately 90 mV for the QB/QB- - couple and 40 mV for the QB- -/QBH2 couple in cyanobacteria, with similar principles applicable to C. reinhardtii . This stability is crucial for the proper functioning of the two-electron gate mechanism in PSII.

What structural features define the QB binding niche in C. reinhardtii?

The QB binding niche in C. reinhardtii is defined by specific amino acid residues within the D1 protein that create a pocket optimized for plastoquinone binding. Key features include:

  • Phenylalanine at position 265 (F265) plays a crucial role in defining the binding properties, particularly for both the natural substrate plastoquinone and herbicides like atrazine .

  • The binding site architecture facilitates hydrogen bonding and van der Waals interactions that stabilize the bound quinone in proper orientation for electron transfer.

  • The site undergoes conformational changes during the reduction process, accommodating the semiquinone intermediate and the fully reduced plastoquinol.

Molecular dynamics simulations have been used to analyze the electrostatic interactions within this pocket, with the binding energy calculated as: ΔGel = Gelcomplex - (GelPSII + Gelligand) . These electrostatic interactions contribute significantly to the specificity and affinity of the binding site for its substrates.

How can the QB binding site be modified to create Chlamydomonas strains with altered herbicide sensitivity?

The QB binding site can be strategically modified through site-directed mutagenesis to alter herbicide sensitivity. Research has demonstrated that specific mutations at residues within the QB binding pocket, particularly the F265 position of the D1 protein, can significantly change the binding properties for herbicides like atrazine (ATZ) .

To create strains with altered herbicide sensitivity:

  • Target the F265 residue in the D1 protein using site-directed mutagenesis. Mutations such as F265T (phenylalanine to threonine) and F265S (phenylalanine to serine) have been successfully implemented to increase atrazine sensitivity .

  • Use biolistic transformation of deletion mutants (such as Del1) to introduce the desired mutations. This approach has been demonstrated effective in the creation of the F265T and F265S mutants .

  • Confirm successful transformation through DNA sequencing and phenotypic testing for herbicide sensitivity.

  • Evaluate the binding affinity changes through molecular dynamics simulations, comparing the electrostatic binding energy of herbicides in wild-type versus mutant strains.

The resulting strains with enhanced herbicide sensitivity can serve as effective biosensors for environmental monitoring of herbicide contamination .

What methods are used to characterize QB site function in recombinant C. reinhardtii?

Several sophisticated methods are employed to characterize QB site function in recombinant C. reinhardtii:

How does the F265 mutation affect electron transfer and protonation at the QB site?

The F265 mutations (F265T and F265S) in the D1 protein significantly alter the electron transfer properties at the QB site. These effects include:

  • Reduced Driving Force: Fluorescence and thermoluminescence data indicate that these mutations result in a weak driving force for electron transfer from QA to QB, resulting in slower electron transfer kinetics .

  • Possible Protonation Effects: While the primary effect appears to be on electron transfer, these mutations may also affect the protonation processes of QB- - or QB2-, influencing the formation of QBH2 .

  • Light-Dependent Efficiency: Interestingly, both F265T and F265S mutants can grow autotrophically, but require strong light for optimal PSII function. In low light conditions, photosynthesis is very slow, but approaches control rates under strong illumination .

  • Evolutionary Implications: This light-dependent behavior resembles what might be expected in an ancestral homodimeric reaction center, suggesting these mutations may reveal characteristics of evolutionary precursors to modern PSII .

The F265 mutants retain a functional two-electron gate at the QB site despite these alterations, allowing them to complete the full photosynthetic electron transport process, albeit with modified kinetics and efficiency.

What is the relationship between QB function and hydrogen production in C. reinhardtii?

The QB site plays a crucial role in hydrogen production in C. reinhardtii, particularly during sulfur deprivation conditions when hydrogen production is enhanced. Research has revealed several important aspects of this relationship:

  • PSII Contribution to H2 Production: Experiments with DCMU, which blocks electron transfer at the QB site, demonstrated that approximately 80% of hydrogen production is inhibited when DCMU is present. This confirms that the majority of electrons delivered to the hydrogenase originate from water oxidation via PSII activity .

  • PSII Stability During H2 Production: During sulfur deprivation, PSII quantity decreases to approximately 25% of original levels but remains functional. This preservation is critical for sustained hydrogen production .

Table: PSII Levels During Different Phases of Sulfur Deprivation

PhaseDescriptionPSII Level (% of Initial)
IAerobic100%
IITransitionDecreasing
IIIAnaerobic~25%
IVH2 Production~25%
  • Anaerobic Protection: The anaerobic environment during hydrogen production helps preserve PSII from irreversible photoinhibition. This occurs because D1 protein degradation is largely O2-dependent, and its absence allows PSII centers to maintain their electron transport capacity .

  • Electron Flow Regulation: During the anaerobic phase preceding hydrogen formation, electron transport from PSII is completely blocked. This block is released during the hydrogen production phase, as the hydrogenase draws electrons from the plastoquinone pool, allowing electron flow from water oxidation to the hydrogenase .

  • Mutant Enhancement: The state transition mutant Stm6, which has higher respiration rates, demonstrates enhanced hydrogen production compared to wild-type strains. This suggests that mutants with enhanced respiratory activity should be considered for improved photobiological hydrogen production .

What are the redox properties of QB in PSII and how do they influence electron transport?

The redox properties of QB in PSII are fundamental to understanding electron transport dynamics. Recent research has provided precise measurements of these properties:

  • Redox Couple Potentials: EPR spectroscopy measurements in cyanobacteria (Thermosynechococcus elongatus) have determined that the midpoint potential (Em) for QB/QB- - is approximately 90 mV, while Em for QB- -/QBH2 is approximately 40 mV . Similar principles likely apply to C. reinhardtii PSII.

  • Thermodynamic Stability: The semiquinone (QB- -) is thermodynamically stable, which minimizes back-reactions and electron leakage to O2, explaining the remarkable stability of QB- - during electron transport .

  • Driving Force for Electron Transfer: The difference between the Em values of QB/QB- - and QA/QA- - (reported as ~234 meV) represents the driving force for electron transfer from QA- - to QB. This value is significantly larger than the generally accepted value of ~70 meV, which has implications for our understanding of electron transport kinetics .

  • Product Release Energetics: The calculated Em for QB/QBH2 (~65 mV) is lower than the Em for free PQ/PQH2 (~117 mV), with the difference (~50 meV) representing the driving force for QBH2 release into the plastoquinone pool .

  • Binding Preference: PQ is approximately 50 times more tightly bound than PQH2, which optimizes PSII function even in the presence of a largely reduced plastoquinone pool .

How does the PSII repair cycle interact with the QB site function?

The PSII repair cycle and QB site function are intimately connected, with the QB site often being a primary target of photodamage that necessitates repair:

  • Repair Intermediate Complex: Recent research has identified a PSII-repair intermediate complex in C. reinhardtii that contains three protein factors associated with damaged PSII: Thylakoid Enriched Factor 14 (TEF14), Photosystem II Repair Factor 1 (PRF1), and Photosystem II Repair Factor 2 (PRF2) .

  • QB Site Blockage: PRF2 specifically functions to block the QB site during the repair process, preventing further electron transport through the damaged complex and potentially reducing additional damage .

  • Photoinhibition and Recovery: When PSII is photoinhibited, it often results in an inhibited form with no bound QB and semistable QA-. This photoinhibition is reversible, allowing these PSII centers to restore their electron transport capacity once the PQ pool and QA- are reoxidized .

  • Photoprotective Mechanisms: The α-tocopherol quinone molecule located adjacent to the heme group of cytochrome b559 may fulfill a photoprotective role by preventing the generation of reactive oxygen species that could damage the QB site and other PSII components .

  • LHL4 Protection: UV-B induced LHL4 (Light-Harvesting-Like protein 4) protects PSII from photodamage, as demonstrated through measurements of maximum quantum yield (Fv/Fm) during high light exposure with and without chloroplast translation inhibition by lincomycin .

Understanding this interplay between damage, protection, and repair is essential for engineering more robust photosynthetic systems and optimizing conditions for applications such as hydrogen production.

What protocols are recommended for measuring QB redox properties in recombinant C. reinhardtii?

For accurate measurement of QB redox properties in recombinant C. reinhardtii, the following protocols are recommended:

These protocols provide complementary information about QB redox properties and should be used in combination for comprehensive characterization.

How can molecular dynamics simulations be optimized for studying QB site mutations?

Molecular dynamics (MD) simulations offer powerful insights into QB binding site mutations, but require careful optimization:

  • Simulation Setup:

    • Start with high-resolution crystal structures of PSII (preferably from C. reinhardtii or closely related species).

    • Create in silico mutations of target residues (e.g., F265T, F265S) using appropriate modeling software.

    • Include the complete PSII complex with the natural ligand QB and/or herbicides like atrazine (ATZ) .

  • Simulation Parameters:

    • Run simulations for at least 10 ns to ensure equilibration and reliable results.

    • Use appropriate force fields that accurately represent protein-ligand interactions.

    • Employ periodic boundary conditions and include explicit solvent and membrane environment .

  • Energy Calculations:

    • Calculate the electrostatic component of binding energy using the formula:
      ΔGel = Gelcomplex - (GelPSII + Gelligand)

    • This quantifies how mutations affect the binding affinity of QB or herbicides .

  • Validation Approaches:

    • Compare simulation results with experimental measurements of binding affinity.

    • Analyze hydrogen bonding patterns and other non-covalent interactions.

    • Examine conformational changes in the binding pocket during the simulation.

  • Advanced Analysis:

    • Implement enhanced sampling techniques such as replica exchange or metadynamics to overcome energy barriers.

    • Calculate free energy profiles along reaction coordinates relevant to binding/unbinding processes.

    • Analyze water molecule dynamics within the binding pocket, as these can significantly influence ligand binding.

By optimizing these aspects of MD simulations, researchers can obtain detailed insights into how specific mutations affect QB binding, electron transfer, and herbicide sensitivity.

What approaches can be used to study the relationship between QB function and hydrogen production?

To investigate the relationship between QB function and hydrogen production in C. reinhardtii, several integrated approaches can be employed:

  • Inhibitor Studies:

    • Use DCMU to specifically block electron transfer at the QB site.

    • Quantify the percentage of hydrogen production inhibited by DCMU (typically ~80%).

    • This approach determines the contribution of PSII-derived electrons to hydrogen production .

  • Tracking PSII Status During Hydrogen Production:

    • Monitor PSII quantity and functional status using EPR spectroscopy throughout the sulfur deprivation process.

    • Divide the incubation period into distinct phases (aerobic, transition, anaerobic, H2 production).

    • Correlate PSII status with hydrogen production rates .

  • Mutant Analysis:

    • Compare hydrogen production in wild-type versus mutant strains with altered QB site properties.

    • Study state transition mutants like Stm6, which exhibit enhanced respiratory activity and hydrogen production.

    • Analyze how specific QB site mutations affect the onset of anaerobiosis and PSII stability .

  • Combined Biophysical Techniques:

    • Integrate measurements from variable fluorescence, EPR spectroscopy, and thermoluminescence.

    • This multi-faceted approach provides a comprehensive view of electron transport from water oxidation to hydrogenase via the QB site .

  • Environmental Condition Optimization:

    • Investigate how light intensity affects electron transport through mutated QB sites.

    • Determine optimal conditions for hydrogen production based on understanding of QB function.

    • Test the hypothesis that faster onset of anaerobiosis preserves PSII from irreversible photoinhibition .

These approaches collectively provide a detailed understanding of how QB site function influences hydrogen production, potentially leading to enhanced photobiological hydrogen production systems.

What are the potential applications of QB site engineering in improving photosynthetic efficiency?

Engineering the QB site offers several promising avenues for improving photosynthetic efficiency:

These applications represent valuable targets for future research, potentially contributing to improved agricultural productivity, renewable energy production, and environmental monitoring technologies.

How might the QB site be involved in photoprotection mechanisms in Chlamydomonas reinhardtii?

The QB site plays a significant role in photoprotection mechanisms in C. reinhardtii through several pathways:

  • Regulation of Electron Transport: By modulating electron flow through PSII, the QB site helps prevent over-reduction of the electron transport chain during high light exposure, reducing the risk of photodamage .

  • Integration with Repair Factors: The PSII repair cycle includes specific factors like PRF2 that interact with the QB site during repair processes, suggesting coordinated photoprotection and repair mechanisms .

  • α-Tocopherol Quinone Protection: The discovery of α-tocopherol quinone located near cytochrome b559 suggests a photoprotective role in preventing reactive oxygen species generation near the QB site .

  • LHL4-Mediated Protection: The light-harvesting-like protein LHL4, induced by photoreceptors in response to UV-B exposure, protects PSII from photodamage, potentially by influencing electron transport through the QB site .

  • Semiquinone Stability: The thermodynamic stability of QB- - minimizes back-reactions and electron leakage to oxygen, reducing the formation of damaging reactive oxygen species .

Understanding these photoprotection mechanisms could lead to the development of photosynthetic organisms with enhanced resilience to light stress, ultimately improving productivity in both natural and engineered systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.