Recombinant Chlamydophila abortus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biological Role in Pathogenesis

LspA processes lipoproteins critical for bacterial membrane assembly and host interaction. C. abortus lipoproteins contribute to immune evasion and persistence, with genomic studies revealing conserved virulence factors among Chlamydiaceae . The absence of toxin genes in C. abortus suggests that structural components like LspA may drive pathogenicity through alternative mechanisms .

Diagnostic and Research Applications

Recombinant LspA is utilized in serological assays to detect C. abortus infections. Studies show that recombinant outer membrane proteins (e.g., POMP90) improve diagnostic sensitivity compared to traditional methods like complement fixation tests . While direct data on LspA-based diagnostics is limited, its structural homology to immunogenic proteins like POMP90 supports its potential utility .

Comparative Genomic Insights

Whole-genome sequencing of C. abortus strain S26/3 reveals 961 coding sequences, including 18 polymorphic membrane proteins (Pmps) and conserved type III secretion systems . LspA is part of the core genome shared with Chlamydophila pneumoniae and Chlamydia trachomatis, highlighting its essential role in bacterial survival .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; CAB205; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Chlamydia abortus (strain DSM 27085 / S26/3) (Chlamydophila abortus)
Target Names
lspA
Target Protein Sequence
MSSRSRSTFLAIACFVLIDWVTKLAVLLYLGNLPDANPILYQYSWGKLLFCICPTFNEGA AFGLFAKYKYFLFFIRITIILGILAFLFLRKKTSSPAIRFSLILLCSGAIGNVGDIVFYR HVVDFISIGYKRWFFPTFNFADIFISLGTLIFIYKLYFPTKQKIK
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: cab:CAB205

STRING: 218497.CAB205

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Chlamydophila abortus and what clinical significance does it have?

Chlamydophila abortus (Cp. abortus) is a bacterial pathogen derived as a new species from Cp. psittaci with nearly 100% conservation in ribosomal and ompA genes . It is primarily known as the causative agent of enzoonotic abortion in sheep flocks worldwide, particularly in the eastern Alps . The pathogen causes severe reproductive issues in sheep, including spontaneous abortion, stillbirth, or delivery of weak lambs, resulting in significant economic losses in sheep-rearing countries .

What is Lipoprotein signal peptidase (LspA) and what is its function in bacterial systems?

Lipoprotein signal peptidase II (LspA) is a critical enzyme in the bacterial lipoprotein processing pathway. Its primary function is to cleave the signal peptide (SP) from prolipoprotein (pBLP), producing diacylated bacterial lipoproteins (DA-BLP) . This processing step is essential for proper lipoprotein maturation and localization within the bacterial cell.

The functional significance of LspA lies in its role within the bacterial lipoprotein modification pathway, which typically involves multiple sequential steps:

  • Initial processing of preprolipoproteins by modification enzymes

  • Cleavage of the signal peptide by LspA

  • Further modifications that may occur post-cleavage

The enzyme's function is critical for bacterial viability and pathogenesis, as bacterial lipoproteins serve various essential functions including nutrient acquisition, cell wall integrity maintenance, and host-pathogen interactions.

Why is recombinant Cp. abortus LspA important for research applications?

Recombinant Cp. abortus LspA provides researchers with a valuable tool for investigating bacterial pathogenesis mechanisms and developing antimicrobial strategies. The importance stems from several key factors:

  • Pathogenesis studies: Recombinant LspA enables detailed investigation of lipoprotein processing in Cp. abortus, which may contribute to virulence and infection mechanisms.

  • Comparative analysis: By studying recombinant Cp. abortus LspA alongside LspA from other bacterial species, researchers can identify unique features that might explain species-specific aspects of pathogenesis.

  • Drug development platform: As demonstrated with other bacterial species, LspA represents a potential target for antimicrobial development. The availability of recombinant Cp. abortus LspA facilitates inhibitor screening and characterization studies.

  • Structural biology applications: Purified recombinant LspA enables structural studies that can reveal critical insights into enzyme function and inform structure-based drug design approaches.

  • Immunological research: Recombinant LspA can be used to investigate immune responses to Cp. abortus infection, potentially leading to vaccine development strategies.

What expression systems are most effective for producing recombinant Cp. abortus LspA?

While the search results don't specifically address expression systems for Cp. abortus LspA, researchers typically employ several approaches for membrane-bound bacterial enzymes like LspA:

E. coli Expression Systems:

  • BL21(DE3) strains are commonly used for expression of prokaryotic membrane proteins

  • Addition of fusion tags (His6, GST, MBP) can facilitate purification while potentially enhancing solubility

  • Codon optimization may be necessary to account for differential codon usage between Cp. abortus and E. coli

  • Induction conditions require careful optimization, with lower temperatures (16-25°C) often yielding better results for membrane proteins

Cell-Free Expression Systems:

  • Particularly valuable for membrane proteins that may be toxic when expressed in living cells

  • Allow for the direct incorporation of detergents or lipids during synthesis

  • Enable rapid screening of expression conditions without the need for transformation and cell culture

For optimal results, empirical testing of multiple expression constructs with various fusion partners and expression conditions is recommended. Given LspA's nature as a membrane-associated enzyme, detergent selection during purification will be critical for maintaining enzymatic activity.

What assays can be used to measure recombinant Cp. abortus LspA activity?

Based on research with LspA from other bacterial species, several assay formats can be adapted for measuring Cp. abortus LspA activity:

SDS-PAGE Gel-Shift Assay:
This established method has been successfully used for LspA activity assessment. The procedure involves:

  • Conversion of a prepro-protein substrate to prolipoprotein using appropriate lipid substrates (e.g., dioleoylphosphatidylglycerol)

  • Incubation with LspA to cleave the signal peptide

  • Analysis by SDS-PAGE to detect the molecular weight shift (~10 kDa) resulting from signal peptide cleavage

  • Quantification of LspA activity by measuring the signal intensity of the product (e.g., diacylated protein)

This assay has been successfully used to identify specific inhibitors of LspA, making it valuable for both basic research and inhibitor screening applications .

Fluorescence-Based Assays:
Although not specifically mentioned in the search results, fluorescence-based assays using synthetic peptide substrates with fluorophore-quencher pairs are commonly employed for protease activity measurements:

  • Design of peptides containing the LspA recognition sequence

  • Incorporation of a fluorophore and quencher at opposing ends of the peptide

  • Upon cleavage by LspA, separation of the fluorophore from the quencher results in increased fluorescence

  • Continuous monitoring of fluorescence provides real-time activity measurements

How can researchers optimize the purification of recombinant Cp. abortus LspA?

Purification of membrane proteins like LspA requires specialized approaches:

Key Purification Considerations:

  • Membrane extraction: Effective solubilization using appropriate detergents (commonly DDM, LDAO, or CHAPS) without compromising protein activity

  • Affinity chromatography: Utilizing fusion tags (His6, GST) for initial capture, with careful optimization of binding and elution conditions

  • Size exclusion chromatography: To separate monomeric protein from aggregates and remove remaining impurities

  • Detergent exchange: If needed for downstream applications, replacing harsh solubilization detergents with milder ones

Critical Parameter Optimization:

  • Detergent concentration: Use the minimum required for solubilization to avoid denaturation

  • Buffer composition: Include stabilizing agents such as glycerol (10-20%) and reducing agents

  • Temperature control: Perform purification steps at 4°C to minimize proteolysis and denaturation

  • Protease inhibitors: Include a comprehensive cocktail to prevent degradation

A systematic approach testing various detergents, buffer compositions, and purification conditions will likely be necessary to achieve optimal results with recombinant Cp. abortus LspA.

What structural features characterize bacterial LspA enzymes and how might they apply to Cp. abortus LspA?

While specific structural information for Cp. abortus LspA is not provided in the search results, general characteristics of bacterial LspA enzymes include:

Structural Features:

  • Membrane-embedded architecture with multiple transmembrane domains

  • Active site typically located within the membrane bilayer or at the membrane interface

  • Conserved catalytic residues essential for proteolytic activity

  • Substrate recognition features that interact with lipobox motifs in target lipoproteins

Understanding these structural elements is essential for rational inhibitor design and mechanistic studies. Computational approaches including homology modeling based on related bacterial LspA structures could provide preliminary structural insights for Cp. abortus LspA while experimental structures are being pursued.

How does substrate specificity of Cp. abortus LspA compare with LspA enzymes from other bacterial species?

Substrate specificity for LspA enzymes is typically defined by recognition of the lipobox motif in prolipoproteins. While specific comparison data for Cp. abortus LspA is not provided in the search results, researchers could investigate substrate specificity through:

  • Sequence analysis of Cp. abortus lipoprotein precursors to identify potential variations in lipobox motifs

  • Biochemical assays comparing cleavage efficiency of various substrate sequences

  • Cross-species activity tests examining whether Cp. abortus LspA can process substrates from other bacterial species and vice versa

Such comparative analyses could reveal insights into evolutionary adaptation of substrate recognition and potential species-specific targeting strategies.

What role might LspA play in Cp. abortus pathogenesis?

Based on the established role of bacterial lipoproteins in pathogenesis, LspA likely contributes to Cp. abortus virulence through several mechanisms:

Potential Pathogenic Roles:

  • Surface lipoprotein processing: LspA processes lipoproteins that may function in adhesion, immune evasion, or nutrient acquisition

  • Inflammatory response modulation: Correctly processed bacterial lipoproteins can trigger inflammatory responses through TLR2 recognition

  • Cellular stress response: Evidence suggests that inflammation and tissue damage in chronic PID may involve immunopathologic reactions against bacterial heat-shock proteins, which share high amino acid identity across Chlamydiaceae species (e.g., 93% identity between C. trachomatis and Cp. caviae hsp60)

The documented case of Cp. abortus causing pelvic inflammatory disease suggests it can cause pathogenesis similar to C. trachomatis, potentially through similar pathways involving properly processed bacterial lipoproteins . LspA's role in ensuring correct lipoprotein processing therefore likely contributes to pathogenic potential.

What approaches have been used to develop inhibitors against bacterial LspA enzymes?

The search results provide insights into inhibitor development strategies for bacterial LspA:

Computational Design Approach:
Researchers have used computational peptide design to develop mimetics of globomycin (a known LspA inhibitor) with enhanced stability:

  • Replacing the labile depsipeptide ester moiety with more stable amide linkages

  • Maintaining the macrocycle structure and chemical affinity for LspA binding

  • Exploring canonical and non-canonical amino acids to replace the depsipeptide segment

  • Targeting sequences predicted to fold similarly to key segments in the LspA-globomycin complex crystal structure (PDB ID 5DIR)

  • Selecting designed sequences confidently predicted by Rosetta (Pnear value of 0.6) to generate structures with desired properties

This computational approach led to multiple generations of compounds. First-generation compounds maintained structural conservation with variations in stereochemistry at the lipid and β-amino acid positions, while preserving the 19-atom macrocycle structure .

Assay-Based Validation:
The effectiveness of designed inhibitors was tested using the SDS-PAGE gel-shift assay described previously, which confirmed that selected compounds acted as specific inhibitors of LspA .

What methodological approaches can researchers use to screen for novel Cp. abortus LspA inhibitors?

Based on the available information, researchers could employ several complementary approaches:

Structure-Based Virtual Screening:

  • Generate a homology model of Cp. abortus LspA based on available LspA structures

  • Perform molecular docking of compound libraries targeting the active site

  • Prioritize compounds based on predicted binding energy and interactions with catalytic residues

  • Experimentally validate top candidates using activity assays

Fragment-Based Drug Discovery:

  • Screen libraries of low molecular weight fragments for binding to LspA

  • Identify binding hotspots using biophysical methods (NMR, X-ray, thermal shift)

  • Link, merge, or grow fragments to generate more potent inhibitors

  • Perform structure-activity relationship studies to optimize potency

Repurposing FDA-Approved Antimicrobials:

  • Test known antimicrobial compounds for LspA inhibition

  • Focus on molecules with structures similar to established LspA inhibitors

  • Combine with structural insights to identify modification opportunities

High-Throughput Biochemical Screening:

  • Adapt the SDS-PAGE gel-shift assay to a high-throughput format or develop a fluorescence-based assay

  • Screen diverse chemical libraries for inhibitory activity

  • Validate hits with secondary assays and counter-screens

What is the therapeutic potential of targeting Cp. abortus LspA in infections?

The therapeutic potential of targeting LspA in Cp. abortus infections stems from several factors:

Advantages as a Drug Target:

  • Essential enzyme: LspA is critical for proper lipoprotein processing and bacterial viability

  • No human homolog: Reduces risk of off-target effects in humans

  • Conservation: The enzyme is relatively conserved among bacteria, potentially allowing broad-spectrum activity

  • Established precedent: Success with LspA inhibitors in other bacterial species suggests feasibility

Potential Clinical Applications:

  • Treatment of Cp. abortus infections: Both in animal hosts (e.g., sheep) and rare human cases

  • Prevention of zoonotic transmission: Reducing bacterial load in animal reservoirs

  • Combination therapy: Potential synergy with existing antibiotics

Research Considerations:

  • Delivery challenges: Ensuring inhibitors reach intracellular bacteria, as Chlamydiaceae are obligate intracellular pathogens

  • Resistance development: Assessing potential for resistance emergence

  • Host-pathogen interaction: Understanding how disruption of lipoprotein processing affects infection dynamics

What are the primary technical challenges in studying Cp. abortus LspA?

Researchers face several technical challenges when investigating Cp. abortus LspA:

Expression and Purification Barriers:

  • LspA is a membrane protein, making expression and purification technically demanding

  • Maintaining proper folding and activity during purification requires careful detergent selection

  • Achieving sufficient yields for structural studies remains challenging

Biosafety Considerations:

  • Cp. abortus is highly infectious, requiring C3 equipment for culturing

  • Safety protocols limit certain experimental approaches

  • Working with recombinant systems rather than native bacteria adds complexity to interpretation

Assay Development Challenges:

  • Designing specific substrates for Cp. abortus LspA

  • Distinguishing LspA activity from other proteases

  • Developing high-throughput assays that maintain physiological relevance

Structural Analysis Limitations:

  • Obtaining crystal structures of membrane proteins is notoriously difficult

  • Cryo-EM approaches for relatively small membrane proteins present resolution challenges

  • Computational predictions require experimental validation

How might advanced structural biology techniques advance our understanding of Cp. abortus LspA?

Several cutting-edge approaches could provide crucial insights:

Cryo-Electron Microscopy (Cryo-EM):

  • Recent advances in detector technology and processing algorithms have revolutionized membrane protein structural biology

  • Potential to visualize LspA in different conformational states

  • Possibility of capturing enzyme-substrate or enzyme-inhibitor complexes

Integrative Structural Biology:

  • Combining multiple experimental techniques (X-ray crystallography, NMR, SAXS, HDX-MS)

  • Computational methods to integrate diverse structural data

  • Building comprehensive models of LspA function within the membrane environment

Molecular Dynamics Simulations:

  • Investigating conformational dynamics not captured in static structures

  • Exploring substrate binding and product release pathways

  • Simulating how mutations impact enzyme function

What emerging research directions show promise for Cp. abortus LspA investigations?

Several innovative approaches may accelerate Cp. abortus LspA research:

CRISPR-Based Approaches:

  • Genome editing to introduce mutations in lspA

  • CRISPRi for controlled knockdown to study essentiality

  • CRISPR screens to identify genetic interactions with lspA

Systems Biology Integration:

  • Proteomics analysis of the lipoproteome under LspA inhibition

  • Transcriptomics to understand adaptive responses to LspA disruption

  • Metabolomics to identify downstream metabolic effects

Translational Research Opportunities:

  • Development of LspA inhibitors as research tools

  • Investigation of vaccine approaches targeting LspA-processed lipoproteins

  • Diagnostic applications leveraging LspA activity or processed lipoproteins

One Health Approaches:

  • Understanding LspA role in zoonotic transmission of Cp. abortus

  • Comparative analysis across host species

  • Environmental persistence studies related to lipoprotein processing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.