Chlamydophila abortus is a bacterium that causes enzootic abortion in ewes (EAE), a significant cause of abortion in pregnant sheep worldwide . C. abortus is transmitted through contact with infected placentas and uterine discharges, posing risks to both animals and humans . The sulfur-rich protein (Srp) of Chlamydia abortus is a transmembrane protein that is being investigated for its potential as a diagnostic and therapeutic target . Recombinant Srp, produced using E. coli expression systems, is a purified form of this protein used in research .
Recombinant sulfur-rich protein (Srp) has the following characteristics:
Storage: Can be stored at -20°C, but for extended storage, it should be conserved at -20°C or -80°C . Repeated freezing and thawing is not recommended; working aliquots should be stored at 4°C for up to one week .
Immunogen Species: Chlamydia abortus (Chlamydophila abortus)
Sequence: The amino acid sequence of the protein is MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRAFQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEKWRLCKRLLQQLKIF . The full-length protein sequence is MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRAFQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEKWRLCKRLLATTEDILDDGQINQSNTIFTMDSSESTNAAAS .
Source: Produced in vitro using an E. coli expression system .
Tag Info: N-terminal 10xHis-tagged . The tag type will be determined during the production process .
Shelf Life: Liquid form typically maintains stability for 6 months at -20°C/-80°C. Lyophilized form maintains stability for 12 months at -20°C/-80°C .
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .
Recombinant Srp is produced using an E. coli expression system . The protein is expressed with an N-terminal 10xHis-tag, which facilitates purification using affinity chromatography .
Chlamydia species, including C. abortus, depend on host cells for replication, utilizing a complex Type 3 Secretion System (T3SS) for intracellular survival . The sulfur-rich protein (Srp) is likely involved in the bacterium's interaction with the host cell, although its exact function is not yet fully understood .
Recombinant Srp can be utilized in several applications:
Diagnostic Assays: Recombinant Srp can be used to develop diagnostic tests for detecting C. abortus infections in animals. An ELISA test based on recombinant protein fragments can detect antibodies earlier in pregnancy than other tests .
Vaccine Development: Recombinant proteins like Srp can be used as antigens to develop vaccines against C. abortus.
Research: It serves as a tool for studying the immune responses to C. abortus and understanding the pathogenesis of enzootic abortion in ewes.
KEGG: cab:CAB182
Chlamydophila abortus Sulfur-rich protein (srp) is a full-length protein consisting of 160 amino acids. The complete amino acid sequence is:
MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRAFQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEKWRLCKRLLATTEDILDDGQINQSNTIFTMDSSESTNAAAS
Structurally, analysis indicates transmembrane domains consistent with membrane localization, which is critical for its proposed role in chlamydial development. The protein has a UniProt ID of Q5L6T1 and is also referred to as CAB182 in some literature .
Srp exists within the 1,144,377-bp genome of Chlamydophila abortus, which contains 961 predicted coding sequences. The protein appears to be part of the conserved core genome shared with other Chlamydophilae, as 842 proteins are conserved between Cp. abortus, Cp. caviae, and Cp. pneumoniae .
Unlike the polymorphic membrane proteins (Pmps) that demonstrate phase-variable expression through homopolymeric tracts, srp maintains consistent expression. This distinguishes it from proteins like CAB279, CAB596, and CAB598 (Pmp family members), which show evidence of phase variation through slip-strand pairing mechanisms .
While the precise function remains under investigation, several characteristics of srp suggest important roles in the chlamydial developmental cycle. Unlike the highly immunogenic PMPs and TMH/Inc proteins that vary between Chlamydia species, srp appears more conserved.
Current evidence indicates srp may function during the transition between elementary bodies (EB) and reticulate bodies (RB) in the biphasic development cycle of Chlamydophila abortus. The protein's presence in elementary bodies (the infectious form) suggests potential roles in early infection events . Unlike some genomic elements linked to host-specific adaptation (such as tryptophan metabolism genes that are absent in Cp. abortus), srp likely serves a fundamental biological function conserved across chlamydial species .
E. coli has proven to be an effective heterologous expression system for recombinant Chlamydophila abortus srp. When expressing the protein, the following factors should be considered:
Vector design: N-terminal His-tag fusion has been successfully employed for purification
Expression conditions: Standard E. coli culture protocols with IPTG induction
Protein yield: Sufficient quantities can be obtained for analytical and functional studies
A comparison of expression systems for chlamydial proteins indicates:
| Expression System | Advantages | Limitations | Suitability for srp |
|---|---|---|---|
| E. coli | High yield, simple protocols | May lack chlamydial-specific modifications | Excellent for structural studies |
| Yolk sac culture | Native-like modifications | Lower yield, complex procedure | Good for functional studies |
| Mammalian cells | Most native-like processing | Lowest yield, technically challenging | Best for interaction studies |
Purification of recombinant His-tagged srp typically employs immobilized metal affinity chromatography. The resulting protein preparations show greater than 90% purity as determined by SDS-PAGE .
For storage:
Store at -20°C/-80°C upon receipt
Aliquoting is necessary to avoid repeated freeze-thaw cycles
For working stocks, store aliquots at 4°C for up to one week
Reconstitution recommendations:
Briefly centrifuge vials prior to opening
Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Add 5-50% glycerol (final concentration) for long-term storage
Researchers investigating srp's role in pathogenesis employ several complementary approaches:
Immunoblotting: One-dimensional (1-D) and two-dimensional (2-D) gel electrophoresis followed by immunoblotting with sera from infected animals can determine if srp is recognized during infection. Studies with Chlamydophila abortus have identified multiple immunoreactive antigens, though srp's specific immunogenicity requires further characterization .
Ultrastructural analysis: Transmission electron microscopy can differentiate between elementary bodies (EB) and reticulate bodies (RB), allowing examination of srp localization during different developmental stages .
Infection models: Experimental infection of pregnant ewes with 2 × 10^6 inclusion forming units (IFU) of Chlamydophila abortus provides a model system to study protein expression during disease progression .
Unlike the highly variable TMH/Inc and Pmp protein families, which are strong candidates for mediating host tropism and disease causation, srp appears more conserved across Chlamydophila species. Research focus has primarily centered on the polymorphic membrane proteins (Pmps) due to their:
Evidence of phase variation (important for immune evasion)
High immunogenicity in infection models
Experimental data has demonstrated that some Pmp proteins show frameshifted variants in sequence data, suggesting phase-variable expression through slip-strand pairing mechanisms. This characteristic has not been observed with srp, indicating a potentially more constitutive expression pattern .
Developing diagnostic assays for Chlamydophila abortus infection requires identifying antigens that are:
Consistently expressed
Immunogenic during natural infection
Specific to Cp. abortus (for differential diagnosis)
Research with sera from experimentally infected pregnant ewes has identified several immunoreactive antigens. While the major outer membrane protein (MOMP), polymorphic outer membrane protein (POMP), and macrophage infectivity potentiator (MIP) lipoprotein have been specifically identified as immunoreactive , further studies are needed to determine if srp demonstrates similar properties.
A comprehensive diagnostic approach might compare detection of multiple antigens:
| Antigen | Molecular Weight | Seroconversion Timing | Detection in Fetal Sera | Specificity |
|---|---|---|---|---|
| 90 kDa protein | ~90 kDa | 100% by 14 dpi | Not determined | High |
| 40 kDa protein | ~40 kDa | 100% by 14 dpi | Not determined | High |
| 26 kDa protein | ~26 kDa | 75% by 14 dpi | 71% by 43 dpi | Moderate |
| 59 kDa protein | ~59 kDa | 75% by 14 dpi | 43% by 43 dpi | Moderate |
Understanding srp's differential expression and function between elementary bodies (EB) and reticulate bodies (RB) requires careful experimental design:
Purification of distinct developmental forms: Use discontinuous Urografin gradients (40%, 35%, and 30% for RB; 45%, 40%, and 35% for EB) with centrifugation at 50,000 × g for 2 hours at 10°C to separate developmental forms .
Verification of purified fractions: Transmission electron microscopy confirms the morphological purity of EB and RB preparations .
Comparative proteomics: 1-D SDS-PAGE reveals differential protein expression between RB and EB, providing context for srp expression patterns .
Immunoblotting: Immunoblot analysis with sera from infected animals shows significantly more reactive antigens in EB compared to RB, with RB typically showing a single reactive antigen of approximately 26 kDa .
When encountering solubility issues with recombinant srp, consider implementing these methodological solutions:
Buffer optimization: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been successfully employed for srp storage .
Reconstitution protocol adjustments:
For poorly soluble preparations, increase reconstitution time
Consider sonication with brief pulses
Test alternative reconstitution buffers with different ionic strengths
Add non-ionic detergents at low concentrations if membrane association is suspected
Purification strategy modifications:
Include reducing agents during purification
Test different immobilized metal ions for His-tag purification
Consider purification under denaturing conditions followed by refolding
When addressing contradictory results regarding srp function, implement these analytical approaches:
Verification of protein integrity:
Confirm complete amino acid sequence through mass spectrometry
Verify protein folding through circular dichroism
Assess aggregation state through size-exclusion chromatography
Experimental system standardization:
Comprehensive comparative analysis:
The observation that 842 coding sequences are conserved between Cp. abortus, Cp. caviae, and Cp. pneumoniae provides a foundation for comparative genomic studies . Future research could:
Perform comprehensive phylogenetic analysis of srp across all Chlamydiaceae to trace evolutionary patterns
Conduct selective pressure analysis to identify conservation hotspots within the protein
Implement whole-genome sequence analysis to identify genomic neighborhoods and potential operon structures containing srp
Utilize RNA-seq to characterize transcriptional patterns during different developmental stages
While current research has characterized the primary sequence of srp, advanced structural biology approaches could reveal crucial insights:
X-ray crystallography of recombinant srp to determine three-dimensional structure
NMR spectroscopy to analyze dynamics and potential binding interactions
Cryo-electron microscopy to visualize srp in its native membrane environment
Molecular dynamics simulations to predict functional domains and interaction surfaces
Combining these structural approaches with mutational analysis could identify critical residues for srp function and provide targets for therapeutic intervention.
Innovative interdisciplinary approaches for future srp research include:
Systems biology integration:
Metabolomic profiling during different expression states
Network analysis incorporating srp into chlamydial protein interaction maps
Mathematical modeling of developmental transitions incorporating srp dynamics
Immunological investigations:
T-cell epitope mapping of srp for vaccine development
Analysis of srp-specific antibody responses in natural infections
Investigation of srp's potential role in immune evasion strategies
Synthetic biology applications:
Engineering of reporter systems fused to srp for in vivo tracking
Creation of conditional expression systems to manipulate srp levels
Development of srp-based detection systems for diagnostic applications