Recombinant Chlamydophila abortus Sulfur-rich protein (srp)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chlamydophila abortus Sulfur-Rich Protein (Srp)

Chlamydophila abortus is a bacterium that causes enzootic abortion in ewes (EAE), a significant cause of abortion in pregnant sheep worldwide . C. abortus is transmitted through contact with infected placentas and uterine discharges, posing risks to both animals and humans . The sulfur-rich protein (Srp) of Chlamydia abortus is a transmembrane protein that is being investigated for its potential as a diagnostic and therapeutic target . Recombinant Srp, produced using E. coli expression systems, is a purified form of this protein used in research .

Characteristics of Recombinant Srp

Recombinant sulfur-rich protein (Srp) has the following characteristics:

  • Product Code: CSB-CF860147CMAZ

  • Storage: Can be stored at -20°C, but for extended storage, it should be conserved at -20°C or -80°C . Repeated freezing and thawing is not recommended; working aliquots should be stored at 4°C for up to one week .

  • Uniprot No.: Q9AIS6 or Q5L6T1

  • Product Type: Transmembrane Protein or Recombinant Protein

  • Immunogen Species: Chlamydia abortus (Chlamydophila abortus)

  • Sequence: The amino acid sequence of the protein is MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRAFQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEKWRLCKRLLQQLKIF . The full-length protein sequence is MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRAFQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEKWRLCKRLLATTEDILDDGQINQSNTIFTMDSSESTNAAAS .

  • Source: Produced in vitro using an E. coli expression system .

  • Target Names: Srp

  • Protein Names: Sulfur-rich protein

  • Expression Region: Amino acids 1-134 or 1-160

  • Tag Info: N-terminal 10xHis-tagged . The tag type will be determined during the production process .

  • Protein Length: Full length protein

  • Shelf Life: Liquid form typically maintains stability for 6 months at -20°C/-80°C. Lyophilized form maintains stability for 12 months at -20°C/-80°C .

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein .

  • Gene Names: srp, CAB182 (Ordered Locus Names)

Production and Purification

Recombinant Srp is produced using an E. coli expression system . The protein is expressed with an N-terminal 10xHis-tag, which facilitates purification using affinity chromatography .

Function and Significance

Chlamydia species, including C. abortus, depend on host cells for replication, utilizing a complex Type 3 Secretion System (T3SS) for intracellular survival . The sulfur-rich protein (Srp) is likely involved in the bacterium's interaction with the host cell, although its exact function is not yet fully understood .

Potential Applications

Recombinant Srp can be utilized in several applications:

  • Diagnostic Assays: Recombinant Srp can be used to develop diagnostic tests for detecting C. abortus infections in animals. An ELISA test based on recombinant protein fragments can detect antibodies earlier in pregnancy than other tests .

  • Vaccine Development: Recombinant proteins like Srp can be used as antigens to develop vaccines against C. abortus.

  • Research: It serves as a tool for studying the immune responses to C. abortus and understanding the pathogenesis of enzootic abortion in ewes.

Antibody Response

TestOutcome
Recombinant fragment of the polymorphic outer membrane protein POMP90 (rOMP90-4 indirect ELISA)Detected antibody much earlier in pregnancy
Variable segment 2 (VS2) region of the major outer membrane protein (MOMP) (MOMP VS2 iELISA)Detected antibody only at the time of abortion or lambing No anti-MOMP antibody response could be detected in three of seven experimentally infected ewes Failed to detect antibody in an animal that seroconverted during the study

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
srp; CAB182; Sulfur-rich protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Chlamydia abortus (strain DSM 27085 / S26/3) (Chlamydophila abortus)
Target Names
srp
Target Protein Sequence
MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRA FQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEK WRLCKRLLATTEDILDDGQINQSNTIFTMDSSESTNAAAS
Uniprot No.

Target Background

Database Links

KEGG: cab:CAB182

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Chlamydophila abortus Sulfur-rich protein?

Chlamydophila abortus Sulfur-rich protein (srp) is a full-length protein consisting of 160 amino acids. The complete amino acid sequence is:
MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRAFQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEKWRLCKRLLATTEDILDDGQINQSNTIFTMDSSESTNAAAS

Structurally, analysis indicates transmembrane domains consistent with membrane localization, which is critical for its proposed role in chlamydial development. The protein has a UniProt ID of Q5L6T1 and is also referred to as CAB182 in some literature .

How does srp fit into the genomic landscape of Chlamydophila abortus?

Srp exists within the 1,144,377-bp genome of Chlamydophila abortus, which contains 961 predicted coding sequences. The protein appears to be part of the conserved core genome shared with other Chlamydophilae, as 842 proteins are conserved between Cp. abortus, Cp. caviae, and Cp. pneumoniae .

Unlike the polymorphic membrane proteins (Pmps) that demonstrate phase-variable expression through homopolymeric tracts, srp maintains consistent expression. This distinguishes it from proteins like CAB279, CAB596, and CAB598 (Pmp family members), which show evidence of phase variation through slip-strand pairing mechanisms .

What is the hypothesized biological function of srp during infection?

While the precise function remains under investigation, several characteristics of srp suggest important roles in the chlamydial developmental cycle. Unlike the highly immunogenic PMPs and TMH/Inc proteins that vary between Chlamydia species, srp appears more conserved.

Current evidence indicates srp may function during the transition between elementary bodies (EB) and reticulate bodies (RB) in the biphasic development cycle of Chlamydophila abortus. The protein's presence in elementary bodies (the infectious form) suggests potential roles in early infection events . Unlike some genomic elements linked to host-specific adaptation (such as tryptophan metabolism genes that are absent in Cp. abortus), srp likely serves a fundamental biological function conserved across chlamydial species .

What expression systems yield optimal recombinant srp production?

E. coli has proven to be an effective heterologous expression system for recombinant Chlamydophila abortus srp. When expressing the protein, the following factors should be considered:

  • Vector design: N-terminal His-tag fusion has been successfully employed for purification

  • Expression conditions: Standard E. coli culture protocols with IPTG induction

  • Protein yield: Sufficient quantities can be obtained for analytical and functional studies

A comparison of expression systems for chlamydial proteins indicates:

Expression SystemAdvantagesLimitationsSuitability for srp
E. coliHigh yield, simple protocolsMay lack chlamydial-specific modificationsExcellent for structural studies
Yolk sac cultureNative-like modificationsLower yield, complex procedureGood for functional studies
Mammalian cellsMost native-like processingLowest yield, technically challengingBest for interaction studies

What are the optimal purification and storage conditions for recombinant srp?

Purification of recombinant His-tagged srp typically employs immobilized metal affinity chromatography. The resulting protein preparations show greater than 90% purity as determined by SDS-PAGE .

For storage:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary to avoid repeated freeze-thaw cycles

  • For working stocks, store aliquots at 4°C for up to one week

Reconstitution recommendations:

  • Briefly centrifuge vials prior to opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Standard protocols use 50% final glycerol concentration

What experimental approaches are used to study srp's role in pathogenesis?

Researchers investigating srp's role in pathogenesis employ several complementary approaches:

  • Immunoblotting: One-dimensional (1-D) and two-dimensional (2-D) gel electrophoresis followed by immunoblotting with sera from infected animals can determine if srp is recognized during infection. Studies with Chlamydophila abortus have identified multiple immunoreactive antigens, though srp's specific immunogenicity requires further characterization .

  • Ultrastructural analysis: Transmission electron microscopy can differentiate between elementary bodies (EB) and reticulate bodies (RB), allowing examination of srp localization during different developmental stages .

  • Infection models: Experimental infection of pregnant ewes with 2 × 10^6 inclusion forming units (IFU) of Chlamydophila abortus provides a model system to study protein expression during disease progression .

How does srp compare to other membrane proteins in the Chlamydial research landscape?

Unlike the highly variable TMH/Inc and Pmp protein families, which are strong candidates for mediating host tropism and disease causation, srp appears more conserved across Chlamydophila species. Research focus has primarily centered on the polymorphic membrane proteins (Pmps) due to their:

  • Evidence of phase variation (important for immune evasion)

  • High immunogenicity in infection models

  • Variability across chlamydial species

Experimental data has demonstrated that some Pmp proteins show frameshifted variants in sequence data, suggesting phase-variable expression through slip-strand pairing mechanisms. This characteristic has not been observed with srp, indicating a potentially more constitutive expression pattern .

What role might srp play in diagnostic assay development?

Developing diagnostic assays for Chlamydophila abortus infection requires identifying antigens that are:

  • Consistently expressed

  • Immunogenic during natural infection

  • Specific to Cp. abortus (for differential diagnosis)

Research with sera from experimentally infected pregnant ewes has identified several immunoreactive antigens. While the major outer membrane protein (MOMP), polymorphic outer membrane protein (POMP), and macrophage infectivity potentiator (MIP) lipoprotein have been specifically identified as immunoreactive , further studies are needed to determine if srp demonstrates similar properties.

A comprehensive diagnostic approach might compare detection of multiple antigens:

AntigenMolecular WeightSeroconversion TimingDetection in Fetal SeraSpecificity
90 kDa protein~90 kDa100% by 14 dpiNot determinedHigh
40 kDa protein~40 kDa100% by 14 dpiNot determinedHigh
26 kDa protein~26 kDa75% by 14 dpi71% by 43 dpiModerate
59 kDa protein~59 kDa75% by 14 dpi43% by 43 dpiModerate

What experimental approaches can distinguish srp's role in different developmental stages?

Understanding srp's differential expression and function between elementary bodies (EB) and reticulate bodies (RB) requires careful experimental design:

  • Purification of distinct developmental forms: Use discontinuous Urografin gradients (40%, 35%, and 30% for RB; 45%, 40%, and 35% for EB) with centrifugation at 50,000 × g for 2 hours at 10°C to separate developmental forms .

  • Verification of purified fractions: Transmission electron microscopy confirms the morphological purity of EB and RB preparations .

  • Comparative proteomics: 1-D SDS-PAGE reveals differential protein expression between RB and EB, providing context for srp expression patterns .

  • Immunoblotting: Immunoblot analysis with sera from infected animals shows significantly more reactive antigens in EB compared to RB, with RB typically showing a single reactive antigen of approximately 26 kDa .

How can researchers address protein solubility issues with recombinant srp?

When encountering solubility issues with recombinant srp, consider implementing these methodological solutions:

  • Buffer optimization: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been successfully employed for srp storage .

  • Reconstitution protocol adjustments:

    • For poorly soluble preparations, increase reconstitution time

    • Consider sonication with brief pulses

    • Test alternative reconstitution buffers with different ionic strengths

    • Add non-ionic detergents at low concentrations if membrane association is suspected

  • Purification strategy modifications:

    • Include reducing agents during purification

    • Test different immobilized metal ions for His-tag purification

    • Consider purification under denaturing conditions followed by refolding

What approaches can clarify contradictory findings in srp functional studies?

When addressing contradictory results regarding srp function, implement these analytical approaches:

  • Verification of protein integrity:

    • Confirm complete amino acid sequence through mass spectrometry

    • Verify protein folding through circular dichroism

    • Assess aggregation state through size-exclusion chromatography

  • Experimental system standardization:

    • Clearly define the chlamydial strains used (S26/3 is the reference strain for Cp. abortus)

    • Standardize purification methodologies for developmental forms

    • Use consistent infection models (e.g., McCoy cells for in vitro studies)

  • Comprehensive comparative analysis:

    • Employ both 1-D and 2-D gel electrophoresis for protein characterization

    • Include multiple timepoints in infection studies (0, 7, 14, 21, 27, 30, 35, 40, and 43 days post-infection)

    • Compare results across different host systems

What genomic approaches could enhance understanding of srp conservation and evolution?

The observation that 842 coding sequences are conserved between Cp. abortus, Cp. caviae, and Cp. pneumoniae provides a foundation for comparative genomic studies . Future research could:

  • Perform comprehensive phylogenetic analysis of srp across all Chlamydiaceae to trace evolutionary patterns

  • Conduct selective pressure analysis to identify conservation hotspots within the protein

  • Implement whole-genome sequence analysis to identify genomic neighborhoods and potential operon structures containing srp

  • Utilize RNA-seq to characterize transcriptional patterns during different developmental stages

How might structural biology techniques advance srp research?

While current research has characterized the primary sequence of srp, advanced structural biology approaches could reveal crucial insights:

  • X-ray crystallography of recombinant srp to determine three-dimensional structure

  • NMR spectroscopy to analyze dynamics and potential binding interactions

  • Cryo-electron microscopy to visualize srp in its native membrane environment

  • Molecular dynamics simulations to predict functional domains and interaction surfaces

Combining these structural approaches with mutational analysis could identify critical residues for srp function and provide targets for therapeutic intervention.

What interdisciplinary approaches might yield novel insights into srp biology?

Innovative interdisciplinary approaches for future srp research include:

  • Systems biology integration:

    • Metabolomic profiling during different expression states

    • Network analysis incorporating srp into chlamydial protein interaction maps

    • Mathematical modeling of developmental transitions incorporating srp dynamics

  • Immunological investigations:

    • T-cell epitope mapping of srp for vaccine development

    • Analysis of srp-specific antibody responses in natural infections

    • Investigation of srp's potential role in immune evasion strategies

  • Synthetic biology applications:

    • Engineering of reporter systems fused to srp for in vivo tracking

    • Creation of conditional expression systems to manipulate srp levels

    • Development of srp-based detection systems for diagnostic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.